++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=Indian/Comoro
Choosen random timezone Indian/Comoro
+ echo 'Choosen random timezone Indian/Comoro'
+ ln -snf /usr/share/zoneinfo/Indian/Comoro /etc/localtime
+ echo Indian/Comoro
+ dpkg -i package_folder/clickhouse-common-static_24.3.18.10427.altinitystable+asan_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 49095 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.3.18.10427.altinitystable+asan_amd64.deb ...
Unpacking clickhouse-common-static (24.3.18.10427.altinitystable+asan) ...
Setting up clickhouse-common-static (24.3.18.10427.altinitystable+asan) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.3.18.10427.altinitystable+asan_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 49124 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.3.18.10427.altinitystable+asan_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.3.18.10427.altinitystable+asan) ...
Setting up clickhouse-common-static-dbg (24.3.18.10427.altinitystable+asan) ...
+ dpkg -i package_folder/clickhouse-server_24.3.18.10427.altinitystable+asan_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 49133 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.3.18.10427.altinitystable+asan_amd64.deb ...
Unpacking clickhouse-server (24.3.18.10427.altinitystable+asan) ...
Setting up clickhouse-server (24.3.18.10427.altinitystable+asan) ...
Cannot set 'net_admin' or 'ipc_lock' or 'sys_nice' or 'net_bind_service' capability for clickhouse binary. This is optional. Taskstats accounting will be disabled. To enable taskstats accounting you may add the required capability later manually.
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.3.18.10427.altinitystable+asan_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 49150 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.3.18.10427.altinitystable+asan_amd64.deb ...
Unpacking clickhouse-client (24.3.18.10427.altinitystable+asan) ...
Setting up clickhouse-client (24.3.18.10427.altinitystable+asan) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.3.18.10427.altinitystable (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+ source /utils.lib
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/reverse_dns_query_function.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=0
+ sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=45557760
+ sed --follow-symlinks -i 's|[[:digit:]]\+|45557760|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=21213184
+ sed --follow-symlinks -i 's|[[:digit:]]\+|21213184|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ -n '' ]]
+ ARM=aarch64
++ uname -m
+ OS=x86_64
+ [[ -n 1 ]]
+ echo x86_64
+ [[ '' -eq 1 ]]
+ [[ x86_64 == \a\a\r\c\h\6\4 ]]
+ echo 'Adding azure configuration'
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
x86_64
Adding azure configuration
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n '' ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-07-31T05-46-26Z (commit-id=a9dc061d847277e30c5c6918d6de6f0606f9d285)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ ./minio server --address :11111 ./minio_data
+ grep AccessDenied
+ curl --silent --verbose http://localhost:11111
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-07-31T05-46-26Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:34313 http://127.0.0.1:34313
Docs: https://min.io/docs/minio/linux/index.html
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./18E2D482205D63FF7dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 258 root 8u IPv6 35551 0t0 TCP *:11111 (LISTEN)
minio 258 root 9u IPv4 35550 0t0 TCP localhost:11111 (LISTEN)
minio 258 root 10u IPv6 35552 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
++ ls /usr/share/clickhouse-test/queries/0_stateless/data_minio
+ for file in $(ls "${data_path}")
+ echo 02366_data.jsonl
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl clickminio/test/02366_data.jsonl
02366_data.jsonl
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
Total: 0 B, Transferred: 0 B, Speed: 0 B/s
02731.arrow
+ for file in $(ls "${data_path}")
+ echo 02731.arrow
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow clickminio/test/02731.arrow
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
Total: 3.82 MiB, Transferred: 3.82 MiB, Speed: 80.27 MiB/s
02731.parquet
+ for file in $(ls "${data_path}")
+ echo 02731.parquet
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet clickminio/test/02731.parquet
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
Total: 1.57 MiB, Transferred: 1.57 MiB, Speed: 50.47 MiB/s
02876.parquet
+ for file in $(ls "${data_path}")
+ echo 02876.parquet
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet clickminio/test/02876.parquet
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
Total: 293 B, Transferred: 293 B, Speed: 22.38 KiB/s
+ for file in $(ls "${data_path}")
+ echo a.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv clickminio/test/a.tsv
a.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
Total: 24 B, Transferred: 24 B, Speed: 1.78 KiB/s
b.tsv
+ for file in $(ls "${data_path}")
+ echo b.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv clickminio/test/b.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
Total: 33 B, Transferred: 33 B, Speed: 2.41 KiB/s
+ for file in $(ls "${data_path}")
+ echo c.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv clickminio/test/c.tsv
c.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
Total: 33 B, Transferred: 33 B, Speed: 2.27 KiB/s
tsv_with_header.tsv
+ for file in $(ls "${data_path}")
+ echo tsv_with_header.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv clickminio/test/tsv_with_header.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 44 B, Transferred: 44 B, Speed: 3.25 KiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Oct 29 02:14 .
drwxr-xr-x 1 root root 4.0K Oct 29 02:14 ..
-rw-rw-r-- 1 1000 1000 300 Oct 29 02:10 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 1.6K Oct 27 14:14 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Oct 29 02:14 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Oct 29 02:14 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Oct 29 02:14 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Oct 29 02:14 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 8.6K Oct 29 02:10 broken_tests.json
drwxr-xr-x 5 root root 340 Oct 29 02:13 dev
-rwxr-xr-x 1 root root 0 Oct 29 02:13 .dockerenv
drwxr-xr-x 1 root root 4.0K Oct 29 02:14 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M Jul 31 2024 mc
drwxr-xr-x 2 root root 4.0K Sep 11 2024 media
-rwxr-xr-x 1 root root 99M Jul 31 2024 minio
drwxr-xr-x 4 root root 4.0K Oct 29 02:14 minio_data
drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt
drwxr-xr-x 2 root root 4.0K Sep 11 2024 opt
-rw-r--r-- 1 root root 0 Mar 24 2026 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Oct 29 02:13 package_folder
dr-xr-xr-x 313 root root 0 Oct 29 02:13 proc
-rwxrwxr-x 1 root root 8.2K Oct 31 2024 process_functional_tests_result.py
drwx------ 1 root root 4.0K Oct 29 02:14 root
drwxr-xr-x 1 root root 4.0K Oct 29 02:14 run
-rwxrwxr-x 1 root root 16K Oct 27 14:14 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K Oct 31 2024 setup_export_logs.sh
-rwxrwxr-x 1 root root 351 Oct 27 14:14 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Oct 27 14:14 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv
-rw-rw-r-- 1 root root 13K Oct 27 14:14 stress_tests.lib
dr-xr-xr-x 13 root root 0 Oct 29 02:13 sys
drwxrwxr-x 2 1000 1000 4.0K Oct 29 02:13 test_output
drwxrwxrwt 1 root root 4.0K Oct 29 02:14 tmp
drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr
-rw-rw-r-- 1 root root 833 Oct 27 14:14 utils.lib
drwxr-xr-x 1 root root 4.0K Sep 11 2024 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 488 clickhouse 322u IPv4 37972 0t0 TCP localhost:12222 (LISTEN)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ '[' 1 -gt 1 ']'
+ sudo clickhouse start
chown -R clickhouse: '/var/run/clickhouse-server/'
Will run sudo --preserve-env -u 'clickhouse' /usr/bin/clickhouse-server --config-file /etc/clickhouse-server/config.xml --pid-file /var/run/clickhouse-server/clickhouse-server.pid --daemon
Waiting for server to start
Waiting for server to start
Server started
+ [[ -n '' ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
127.0.0.1 - - [28/Oct/2026:23:14:33 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:14:33 +0000] "PUT /devstoreaccount1/cont/esnylafmletiqhaykcyytcdngsspgnty?blockid=rogifgsplonkedaobowryvgrzbjjbymhvyjtpasbixqhccwbajiwzgwkkdlqlbko&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:14:33 +0000] "PUT /devstoreaccount1/cont/esnylafmletiqhaykcyytcdngsspgnty?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:14:33 +0000] "GET /devstoreaccount1/cont/esnylafmletiqhaykcyytcdngsspgnty HTTP/1.1" 206 4
127.0.0.1 - - [28/Oct/2026:23:14:33 +0000] "GET /devstoreaccount1/cont/esnylafmletiqhaykcyytcdngsspgnty HTTP/1.1" 206 2
127.0.0.1 - - [28/Oct/2026:23:14:33 +0000] "DELETE /devstoreaccount1/cont/esnylafmletiqhaykcyytcdngsspgnty HTTP/1.1" 202 -
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
File /tmp/export-logs-config.sh does not exist, do not setup
+ set +x
+ attach_gdb_to_clickhouse
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
thread apply all backtrace full
info registers
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 678
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ timeout_with_logging 9720 bash -c run_tests
+ local exit_code=0
+ timeout 9720 bash -c run_tests
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 2 ]]
+ [[ -n 4 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ hxBc =~ e ]]
+ set_e=false
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ false
+ return
+ set +e
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 2 --run-by-hash-total 4 --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
+ tee -a test_output/test_result.txt
2026-10-29 02:15:13 Using queries from '/usr/share/clickhouse-test/queries' directory
2026-10-29 02:15:13 Connecting to ClickHouse server... OK
2026-10-29 02:15:13 Connected to server 24.3.18.10427.altinitystable @ fcaf6e1267e237da0994d3e05c9aabfe63c284a1 HEAD
2026-10-29 02:15:13 Found 1430 parallel tests and 137 sequential tests
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-9).
2026-10-29 02:15:14
2026-10-29 02:15:14 03205_system_sync_replica_format: [ OK ] 0.38 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-7).
2026-10-29 02:15:14
2026-10-29 02:15:14 03210_nested_short_circuit_functions_bug: [ OK ] 0.41 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-4).
2026-10-29 02:15:14
2026-10-29 02:15:14 03251_unaligned_window_function_state: [ OK ] 0.58 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-8).
2026-10-29 02:15:14
2026-10-29 02:15:14 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.64 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-3).
2026-10-29 02:15:14
2026-10-29 02:15:14 03303_alias_inverse_order: [ OK ] 0.72 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-6).
2026-10-29 02:15:14
2026-10-29 02:15:14 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.74 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-5).
2026-10-29 02:15:14
2026-10-29 02:15:14 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.71 sec.
2026-10-29 02:15:14
2026-10-29 02:15:14 Running about 178 stateless tests (ForkPoolWorker-2).
2026-10-29 02:15:14
2026-10-29 02:15:14 03290_final_collapsing: [ OK ] 0.88 sec.
2026-10-29 02:15:14 03196_max_intersections_arena_crash: [ OK ] 0.41 sec.
2026-10-29 02:15:14 03165_distinct_with_window_func_crash: [ OK ] 0.38 sec.
2026-10-29 02:15:14 03129_cte_with_final: [ OK ] 0.39 sec.
2026-10-29 02:15:14 03127_argMin_combinator_state: [ OK ] 0.41 sec.
2026-10-29 02:15:14 03152_analyzer_columns_list: [ OK ] 0.46 sec.
2026-10-29 02:15:15 03033_final_undefined_last_mark: [ OK ] 0.23 sec.
2026-10-29 02:15:15 03038_move_partition_to_oneself_deadlock: [ OK ] 0.43 sec.
2026-10-29 02:15:15 03093_bug_gcd_codec: [ OK ] 0.65 sec.
2026-10-29 02:15:15 03019_numbers_pretty: [ OK ] 0.38 sec.
2026-10-29 02:15:15 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.40 sec.
2026-10-29 02:15:15 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.59 sec.
2026-10-29 02:15:15 03015_with_fill_invalid_expression: [ OK ] 0.37 sec.
2026-10-29 02:15:15 03013_position_const_start_pos: [ OK ] 0.35 sec.
2026-10-29 02:15:15 03013_repeat_with_nonnative_integers: [ OK ] 0.37 sec.
2026-10-29 02:15:15 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.54 sec.
2026-10-29 02:15:15 03010_view_prewhere_in: [ OK ] 0.42 sec.
2026-10-29 02:15:16 03008_index_small: [ OK ] 0.50 sec.
2026-10-29 02:15:16 03007_column_nullable_uninitialzed_value: [ OK ] 0.47 sec.
2026-10-29 02:15:17 03006_buffer_overflow_join: [ OK ] 0.46 sec.
2026-10-29 02:15:17 03009_format_show_database: [ OK ] 1.87 sec.
2026-10-29 02:15:17 03172_http_content_encoding: [ OK ] 3.38 sec.
2026-10-29 02:15:17 03005_input_function_in_join: [ OK ] 0.35 sec.
2026-10-29 02:15:18 03020_output_format_client: [ OK ] 3.47 sec.
2026-10-29 02:15:18 03002_analyzer_prewhere: [ OK ] 0.80 sec.
2026-10-29 02:15:19 03003_prql_panic: [ OK ] 1.53 sec.
2026-10-29 02:15:19 02999_analyzer_preimage_null: [ OK ] 0.41 sec.
2026-10-29 02:15:20 03001_bad_error_message_higher_order_functions: [ OK ] 1.64 sec.
2026-10-29 02:15:20 02999_ulid_short_circuit: [ OK ] 0.50 sec.
2026-10-29 02:15:20 02999_scalar_subqueries_bug_2: [ OK ] 0.43 sec.
2026-10-29 02:15:20 02999_scalar_subqueries_bug_1: [ OK ] 0.58 sec.
2026-10-29 02:15:21 02997_projections_formatting: [ OK ] 0.45 sec.
2026-10-29 02:15:21 03012_parser_backtracking: [ OK ] 5.79 sec.
2026-10-29 02:15:21 02995_preliminary_filters_duplicated_columns: [ OK ] 0.42 sec.
2026-10-29 02:15:21 02998_projection_after_attach_partition: [ OK ] 1.08 sec.
2026-10-29 02:15:23 03001_backup_matview_after_modify_query: [ OK ] 4.83 sec.
2026-10-29 02:15:25 02990_format_select_from_explain: [ OK ] 1.38 sec.
2026-10-29 02:15:26 03199_unbin_buffer_overflow: [ OK ] 12.00 sec.
2026-10-29 02:15:26 02995_forget_partition: [ OK ] 4.99 sec.
2026-10-29 02:15:27 03008_uniq_exact_equal_ranges: [ OK ] 11.52 sec.
2026-10-29 02:15:28 02985_minmax_index_aggregate_function: [ OK ] 1.60 sec.
2026-10-29 02:15:28 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.84 sec.
2026-10-29 02:15:29 02982_comments_in_system_tables: [ OK ] 1.93 sec.
2026-10-29 02:15:29 02981_translate_fixedstring: [ OK ] 0.58 sec.
2026-10-29 02:15:30 02985_if_over_big_int_decimal: [ OK ] 4.09 sec.
2026-10-29 02:15:30 03008_filter_projections_non_deterministoc_functions: [ OK ] 14.47 sec.
2026-10-29 02:15:30 02981_variant_type_function: [ OK ] 0.82 sec.
2026-10-29 02:15:30 02989_variant_comparison: [ OK ] 5.29 sec.
2026-10-29 02:15:30 02973_dictionary_table_exception_fix: [ OK ] 0.48 sec.
2026-10-29 02:15:31 02974_analyzer_array_join_subcolumn: [ OK ] 0.83 sec.
2026-10-29 02:15:31 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 13.82 sec.
2026-10-29 02:15:32 02972_to_string_nullable_timezone: [ OK ] 0.50 sec.
2026-10-29 02:15:32 02975_intdiv_with_decimal: [ OK ] 1.98 sec.
2026-10-29 02:15:32 02973_block_number_sparse_serialization_and_mutation: [ OK ] 1.50 sec.
2026-10-29 02:15:33 02971_limit_by_distributed: [ OK ] 1.03 sec.
2026-10-29 02:15:33 02969_analyzer_eliminate_injective_functions: [ OK ] 0.78 sec.
2026-10-29 02:15:34 02968_mysql_prefer_column_name_to_alias: [ OK ] 1.52 sec.
2026-10-29 02:15:34 02969_functions_to_subcolumns_if_null: [ OK ] 1.56 sec.
2026-10-29 02:15:34 02994_sanity_check_settings: [ OK ] 13.16 sec.
2026-10-29 02:15:35 02967_index_hint_crash: [ OK ] 0.41 sec.
2026-10-29 02:15:35 02967_fuzz_bad_cast: [ OK ] 0.52 sec.
2026-10-29 02:15:35 02967_analyzer_fuzz: [ OK ] 0.59 sec.
2026-10-29 02:15:35 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 5.09 sec.
2026-10-29 02:15:35 02962_analyzer_constant_set: [ OK ] 0.53 sec.
2026-10-29 02:15:35 02993_lazy_index_loading: [ OK ] 14.11 sec.
2026-10-29 02:15:36 02963_single_value_destructor: [ OK ] 0.90 sec.
2026-10-29 02:15:36 02960_alter_table_part_query_parameter: [ OK ] 0.43 sec.
2026-10-29 02:15:36 02962_parallel_window_functions_different_partitioning: [ OK ] 0.44 sec.
2026-10-29 02:15:36 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 5.41 sec.
2026-10-29 02:15:36 02953_slow_create_view: [ OK ] 0.48 sec.
2026-10-29 02:15:38 02952_clickhouse_local_query_parameters_cli: [ OK ] 1.54 sec.
2026-10-29 02:15:38 02950_part_log_bytes_uncompressed: [ OK ] 1.38 sec.
2026-10-29 02:15:38 02956_clickhouse_local_system_parts: [ OK ] 2.01 sec.
2026-10-29 02:15:38 02946_literal_alias_misclassification: [ OK ] 0.51 sec.
2026-10-29 02:15:38 02981_vertical_merges_memory_usage: [ OK ] 9.37 sec.
2026-10-29 02:15:38 02950_parallel_replicas_used_count: [ OK ] 1.95 sec.
2026-10-29 02:15:39 02949_parallel_replicas_in_subquery: [ OK ] 0.87 sec.
2026-10-29 02:15:39 02950_reading_array_tuple_subcolumns: [ OK ] 1.13 sec.
2026-10-29 02:15:39 02943_variant_element: [ OK ] 0.44 sec.
2026-10-29 02:15:39 02967_parallel_replicas_joins_and_analyzer: [ OK ] 4.22 sec.
2026-10-29 02:15:40 02935_format_with_arbitrary_types: [ OK ] 1.07 sec.
2026-10-29 02:15:40 02941_projections_external_aggregation: [ OK ] 1.56 sec.
2026-10-29 02:15:41 02932_query_settings_max_size_drop: [ OK ] 0.81 sec.
2026-10-29 02:15:41 02932_group_by_null_fuzzer: [ OK ] 0.53 sec.
2026-10-29 02:15:42 02932_parallel_replicas_fuzzer: [ OK ] 1.51 sec.
2026-10-29 02:15:42 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.77 sec.
2026-10-29 02:15:42 02923_cte_equality_disjunction: [ OK ] 0.43 sec.
2026-10-29 02:15:43 02923_join_use_nulls_modulo: [ OK ] 0.67 sec.
2026-10-29 02:15:43 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 1.40 sec.
2026-10-29 02:15:44 02969_auto_format_detection: [ OK ] 12.14 sec.
2026-10-29 02:15:44 02922_respect_nulls_parser: [ OK ] 0.95 sec.
2026-10-29 02:15:45 02922_respect_nulls_extensive: [ OK ] 1.58 sec.
2026-10-29 02:15:45 02922_respect_nulls_Nullable: [ OK ] 0.90 sec.
2026-10-29 02:15:45 02921_bit_hamming_distance_big_int: [ OK ] 0.45 sec.
2026-10-29 02:15:46 02922_server_exit_code: [ OK ] 1.70 sec.
2026-10-29 02:15:46 02933_group_by_memory_usage: [ OK ] 7.35 sec.
2026-10-29 02:15:47 02920_alter_column_of_projections: [ OK ] 1.60 sec.
2026-10-29 02:15:48 02918_template_format_deadlock: [ OK ] 1.58 sec.
2026-10-29 02:15:48 02963_remote_read_small_buffer_size_bug: [ OK ] 13.21 sec.
2026-10-29 02:15:49 02915_fpc_overflow: [ OK ] 1.38 sec.
2026-10-29 02:15:49 02918_multif_for_nullable: [ OK ] 2.94 sec.
2026-10-29 02:15:49 02915_sleep_large_uint: [ OK ] 0.50 sec.
2026-10-29 02:15:50 02911_analyzer_explain_estimate: [ OK ] 0.45 sec.
2026-10-29 02:15:50 02911_add_index_and_materialize_index: [ OK ] 0.36 sec.
2026-10-29 02:15:51 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 5.58 sec.
2026-10-29 02:15:51 02910_bad_logs_level_in_local: [ OK ] 0.64 sec.
2026-10-29 02:15:51 02915_input_table_function_in_subquery: [ OK ] 2.02 sec.
2026-10-29 02:15:51 02908_filesystem_cache_as_collection: [ OK ] 0.38 sec.
2026-10-29 02:15:52 02906_flatten_only_true_nested: [ OK ] 0.40 sec.
2026-10-29 02:15:53 02907_clickhouse_dictionary_bug: [ OK ] 1.84 sec.
2026-10-29 02:15:54 02903_bug_43644: [ OK ] 0.59 sec.
2026-10-29 02:15:54 02915_lazy_loading_of_base_backups: [ OK ] 5.64 sec.
2026-10-29 02:15:54 02908_Npy_files_caching: [ OK ] 3.28 sec.
2026-10-29 02:15:54 02902_select_subcolumns_from_engine_null: [ OK ] 0.40 sec.
2026-10-29 02:15:54 02904_empty_order_by_with_setting_enabled: [ OK ] 2.63 sec.
2026-10-29 02:15:55 02902_add_scalar_in_all_case: [ OK ] 0.47 sec.
2026-10-29 02:15:56 02900_matview_create_to_errors: [ OK ] 1.59 sec.
2026-10-29 02:15:56 02903_client_insert_in_background: [ OK ] 2.39 sec.
2026-10-29 02:15:57 02899_distributed_limit_by: [ OK ] 1.79 sec.
2026-10-29 02:15:57 02898_parallel_replicas_custom_key_final: [ OK ] 0.60 sec.
2026-10-29 02:15:57 02896_cyclic_aliases_crash: [ OK ] 0.43 sec.
2026-10-29 02:15:57 02941_variant_type_2: [ OK ] 18.87 sec.
2026-10-29 02:15:58 02916_replication_protocol_wait_for_part: [ OK ] 10.76 sec.
2026-10-29 02:15:58 02893_bad_sample_view: [ OK ] 0.37 sec.
2026-10-29 02:15:58 02891_alter_update_adaptive_granularity: [ OK ] 0.47 sec.
2026-10-29 02:15:58 02895_peak_memory_usage_http_headers_regression: [ OK ] 1.68 sec.
2026-10-29 02:15:58 02890_untuple_column_names: [ OK ] 0.65 sec.
2026-10-29 02:15:58 02889_print_pretty_type_names: [ OK ] 0.40 sec.
2026-10-29 02:15:59 02888_obsolete_settings: [ OK ] 0.42 sec.
2026-10-29 02:15:59 02896_leading_zeroes_no_octal: [ OK ] 2.78 sec.
2026-10-29 02:15:59 02884_duplicate_index_name: [ OK ] 0.34 sec.
2026-10-29 02:15:59 02884_string_distance_function: [ OK ] 0.89 sec.
2026-10-29 02:16:00 02882_primary_key_index_in_function_different_types: [ OK ] 0.51 sec.
2026-10-29 02:16:00 02884_parquet_new_encodings: [ OK ] 1.56 sec.
2026-10-29 02:16:00 02882_formatQuery: [ OK ] 0.95 sec.
2026-10-29 02:16:01 02881_system_detached_parts_modification_time: [ OK ] 0.98 sec.
2026-10-29 02:16:03 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 2.42 sec.
2026-10-29 02:16:04 02876_json_incomplete_types_as_strings_inference: [ OK ] 1.19 sec.
2026-10-29 02:16:06 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 1.36 sec.
2026-10-29 02:16:06 02876_yyyymmddtodate: [ OK ] 5.19 sec.
2026-10-29 02:16:06 02900_buffer_table_alter_race: [ OK ] 11.54 sec.
2026-10-29 02:16:07 02875_json_array_as_string: [ OK ] 0.54 sec.
2026-10-29 02:16:08 02874_toDaysSinceYearZero: [ OK ] 1.11 sec.
2026-10-29 02:16:09 02874_analysis_of_variance_overflow: [ OK ] 0.97 sec.
2026-10-29 02:16:10 02877_optimize_read_in_order_from_view: [ OK ] 9.24 sec.
2026-10-29 02:16:10 02872_prewhere_filter: [ OK ] 0.87 sec.
2026-10-29 02:16:10 02883_zookeeper_finalize_stress: [ OK ] 11.25 sec.
2026-10-29 02:16:10 02875_show_functions: [ OK ] 4.58 sec.
2026-10-29 02:16:11 02868_operator_is_not_distinct_from_priority: [ OK ] 0.41 sec.
2026-10-29 02:16:11 02868_select_support_from_keywords: [ OK ] 0.51 sec.
2026-10-29 02:16:11 02870_per_column_settings: [ OK ] 1.06 sec.
2026-10-29 02:16:11 02862_sorted_distinct_sparse_fix: [ OK ] 0.45 sec.
2026-10-29 02:16:11 02864_statistic_exception: [ OK ] 0.89 sec.
2026-10-29 02:16:11 02941_variant_type_4: [ OK ] 32.74 sec.
2026-10-29 02:16:12 02860_distributed_flush_on_detach: [ OK ] 0.55 sec.
2026-10-29 02:16:13 02861_join_on_nullsafe_compare: [ OK ] 2.12 sec.
2026-10-29 02:16:14 02845_parquet_odd_decimals: [ OK ] 2.74 sec.
2026-10-29 02:16:15 02843_date_predicate_optimizations_bugs: [ OK ] 0.47 sec.
2026-10-29 02:16:15 02932_refreshable_materialized_views: [ OK ] 35.55 sec.
2026-10-29 02:16:15 02842_filesystem_cache_validate_path: [ OK ] 0.53 sec.
2026-10-29 02:16:16 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 1.06 sec.
2026-10-29 02:16:16 02842_table_function_file_filter_by_virtual_columns: [ OK ] 1.84 sec.
2026-10-29 02:16:17 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 5.92 sec.
2026-10-29 02:16:17 02895_npy_format: [ OK ] 20.33 sec.
2026-10-29 02:16:18 02841_join_filter_set_sparse: [ OK ] 1.26 sec.
2026-10-29 02:16:18 02842_suggest_http_page_in_error_message: [ OK ] 1.48 sec.
2026-10-29 02:16:18 02840_grace_hash_join_structure_mismatch: [ OK ] 0.50 sec.
2026-10-29 02:16:19 02835_join_step_explain: [ OK ] 0.60 sec.
2026-10-29 02:16:19 02835_fuzz_remove_redundant_sorting: [ OK ] 1.37 sec.
2026-10-29 02:16:20 02845_threads_count_in_distributed_queries: [ OK ] 8.28 sec.
2026-10-29 02:16:20 02834_array_exists_segfault: [ OK ] 0.45 sec.
2026-10-29 02:16:20 02833_std_alias: [ OK ] 0.44 sec.
2026-10-29 02:16:20 02841_parallel_final_wrong_columns_order: [ OK ] 2.95 sec.
2026-10-29 02:16:20 02832_transform_fixed_string_no_default: [ OK ] 0.51 sec.
2026-10-29 02:16:20 02831_trash: [ OK ] 0.39 sec.
2026-10-29 02:16:20 02833_tuple_concat: [ OK ] 0.77 sec.
2026-10-29 02:16:21 02815_first_line: [ OK ] 0.48 sec.
2026-10-29 02:16:21 02815_alias_to_length: [ OK ] 0.39 sec.
2026-10-29 02:16:21 02815_range_dict_no_direct_join: [ OK ] 0.56 sec.
2026-10-29 02:16:21 02841_not_ready_set_bug: [ OK ] 3.66 sec.
2026-10-29 02:16:21 02813_func_now_and_alias: [ OK ] 0.42 sec.
2026-10-29 02:16:22 02813_seriesDecomposeSTL: [ OK ] 0.63 sec.
2026-10-29 02:16:22 02813_func_today_and_alias: [ OK ] 0.45 sec.
2026-10-29 02:16:22 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 9.00 sec.
2026-10-29 02:16:22 02811_invalid_embedded_rocksdb_create: [ OK ] 0.41 sec.
2026-10-29 02:16:22 02813_seriesOutliersDetectTukey: [ OK ] 0.83 sec.
2026-10-29 02:16:22 02812_pointwise_array_operations: [ OK ] 0.84 sec.
2026-10-29 02:16:23 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.50 sec.
2026-10-29 02:16:23 02809_has_token: [ OK ] 0.53 sec.
2026-10-29 02:16:23 02806_cte_block_cannot_be_empty: [ OK ] 0.46 sec.
2026-10-29 02:16:23 02809_has_subsequence: [ OK ] 0.98 sec.
2026-10-29 02:16:24 02798_explain_settings_not_applied_bug: [ OK ] 0.45 sec.
2026-10-29 02:16:24 02797_range_nullable: [ OK ] 0.68 sec.
2026-10-29 02:16:25 02815_no_throw_in_simple_queries: [ OK ] 3.83 sec.
2026-10-29 02:16:25 02811_csv_input_field_type_mismatch: [ OK ] 3.12 sec.
2026-10-29 02:16:26 02793_implicit_pretty_format_settings: [ OK ] 1.73 sec.
2026-10-29 02:16:26 02791_final_block_structure_mismatch_bug: [ OK ] 1.28 sec.
2026-10-29 02:16:26 02792_alter_table_modify_comment: [ OK ] 1.80 sec.
2026-10-29 02:16:26 02790_fix_coredump_when_compile_expression: [ OK ] 0.36 sec.
2026-10-29 02:16:27 02802_clickhouse_disks_s3_copy: [ OK ] 3.65 sec.
2026-10-29 02:16:27 02789_jit_cannot_convert_column: [ OK ] 0.66 sec.
2026-10-29 02:16:28 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.98 sec.
2026-10-29 02:16:28 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.63 sec.
2026-10-29 02:16:28 02788_current_schemas_function: [ OK ] 0.50 sec.
2026-10-29 02:16:28 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.68 sec.
2026-10-29 02:16:29 02784_projections_read_in_order_bug: [ OK ] 0.88 sec.
2026-10-29 02:16:31 02790_url_multiple_tsv_files: [ OK ] 4.89 sec.
2026-10-29 02:16:32 02784_disable_async_with_dedup_correctly: [ OK ] 4.69 sec.
2026-10-29 02:16:33 02782_avro_decimals: [ OK ] 1.90 sec.
2026-10-29 02:16:33 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 1.19 sec.
2026-10-29 02:16:34 02771_if_constant_folding: [ OK ] 0.59 sec.
2026-10-29 02:16:35 02771_ignore_data_skipping_indices: [ OK ] 1.25 sec.
2026-10-29 02:16:35 02766_bitshift_with_const_arguments: [ OK ] 0.65 sec.
2026-10-29 02:16:35 02783_parallel_replicas_trivial_count_optimization: [ OK ] 6.93 sec.
2026-10-29 02:16:36 02764_index_analysis_fix: [ OK ] 0.67 sec.
2026-10-29 02:16:36 02801_backup_native_copy: [ OK ] 12.54 sec.
2026-10-29 02:16:36 02751_multiif_to_if_crash: [ OK ] 0.51 sec.
2026-10-29 02:16:36 02763_row_policy_storage_merge_alias: [ OK ] 0.93 sec.
2026-10-29 02:16:37 02752_space_function: [ OK ] 0.99 sec.
2026-10-29 02:16:38 02751_protobuf_ipv6: [ OK ] 1.83 sec.
2026-10-29 02:16:38 02746_index_analysis_binary_operator_with_null: [ OK ] 0.41 sec.
2026-10-29 02:16:39 02737_sql_auto_is_null: [ OK ] 0.41 sec.
2026-10-29 02:16:39 02735_array_map_array_of_tuples: [ OK ] 0.39 sec.
2026-10-29 02:16:40 02734_big_int_from_float_ubsan: [ OK ] 0.34 sec.
2026-10-29 02:16:40 02817_structure_to_schema: [ OK ] 20.27 sec.
2026-10-29 02:16:41 02734_sparse_columns_short_circuit: [ OK ] 0.59 sec.
2026-10-29 02:16:41 02751_text_formats_bad_nullable_parsing: [ OK ] 4.34 sec.
2026-10-29 02:16:41 02733_sparse_columns_reload: [ OK ] 0.76 sec.
2026-10-29 02:16:41 02844_max_backup_bandwidth_s3: [ OK ] 29.35 sec.
2026-10-29 02:16:41 02751_multiquery_with_argument: [ OK ] 4.72 sec.
2026-10-29 02:16:41 02731_nothing_deserialization: [ OK ] 0.43 sec.
2026-10-29 02:16:42 02724_persist_interval_type: [ OK ] 0.91 sec.
2026-10-29 02:16:42 02723_jit_aggregation_bug_48120: [ OK ] 1.14 sec.
2026-10-29 02:16:43 02723_param_exception_message_context: [ OK ] 1.76 sec.
2026-10-29 02:16:44 02731_replace_partition_from_temporary_table: [ OK ] 2.70 sec.
2026-10-29 02:16:44 02721_url_cluster: [ OK ] 1.97 sec.
2026-10-29 02:16:44 02715_or_null: [ OK ] 0.43 sec.
2026-10-29 02:16:45 02714_date_date32_in: [ OK ] 0.39 sec.
2026-10-29 02:16:45 02713_sequence_match_serialization_fix: [ OK ] 0.64 sec.
2026-10-29 02:16:45 02711_server_uuid_macro: [ OK ] 0.93 sec.
2026-10-29 02:16:46 02711_trim_aliases: [ OK ] 0.51 sec.
2026-10-29 02:16:46 02784_parallel_replicas_automatic_decision: [ OK ] 17.29 sec.
2026-10-29 02:16:46 02707_analyzer_nested_lambdas_types: [ OK ] 0.59 sec.
2026-10-29 02:16:46 02732_rename_after_processing: [ OK ] 5.86 sec.
2026-10-29 02:16:47 02705_settings_check_changed_flag: [ OK ] 0.91 sec.
2026-10-29 02:16:47 02718_cli_dashed_options_parsing: [ OK ] 4.32 sec.
2026-10-29 02:16:47 02718_parquet_metadata_format: [ OK ] 3.43 sec.
2026-10-29 02:16:47 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.55 sec.
2026-10-29 02:16:47 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.52 sec.
2026-10-29 02:16:47 02693_multiple_joins_in: [ OK ] 0.37 sec.
2026-10-29 02:16:47 02695_logical_optimizer_alias_bug: [ OK ] 0.47 sec.
2026-10-29 02:16:48 02691_multiple_joins_backtick_identifiers: [ OK ] 0.50 sec.
2026-10-29 02:16:48 02687_native_fuzz: [ OK ] 0.49 sec.
2026-10-29 02:16:48 02680_default_star: [ OK ] 0.44 sec.
2026-10-29 02:16:48 02688_aggregate_states: [ OK ] 1.21 sec.
2026-10-29 02:16:48 02680_illegal_type_of_filter_projection: [ OK ] 0.53 sec.
2026-10-29 02:16:49 02681_aggregation_by_partitions_bug: [ OK ] 1.14 sec.
2026-10-29 02:16:49 02680_datetime64_monotonic_check: [ OK ] 0.52 sec.
2026-10-29 02:16:49 02702_allow_skip_errors_enum: [ OK ] 2.68 sec.
2026-10-29 02:16:49 02676_trailing_commas: [ OK ] 0.41 sec.
2026-10-29 02:16:49 02676_kafka_murmur_hash: [ OK ] 0.36 sec.
2026-10-29 02:16:49 02675_predicate_push_down_filled_join_fix: [ OK ] 0.66 sec.
2026-10-29 02:16:50 02674_trivial_count_analyzer: [ OK ] 1.46 sec.
2026-10-29 02:16:51 02675_sparse_columns_clear_column: [ OK ] 2.61 sec.
2026-10-29 02:16:52 02594_msgpack_more_types: [ OK ] 1.95 sec.
2026-10-29 02:16:53 02591_bson_long_tuple: [ OK ] 0.37 sec.
2026-10-29 02:16:53 02592_avro_more_types: [ OK ] 2.03 sec.
2026-10-29 02:16:54 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.61 sec.
2026-10-29 02:16:55 02581_width_bucket: [ OK ] 1.26 sec.
2026-10-29 02:16:56 02579_parameterized_replace: [ OK ] 0.34 sec.
2026-10-29 02:16:56 02579_fill_empty_chunk_analyzer: [ OK ] 0.42 sec.
2026-10-29 02:16:56 02584_compressor_codecs: [ OK ] 3.32 sec.
2026-10-29 02:16:56 02572_max_intersections: [ OK ] 0.32 sec.
2026-10-29 02:16:57 02574_suspicious_low_cardinality_msan: [ OK ] 0.69 sec.
2026-10-29 02:16:58 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 51.80 sec.
2026-10-29 02:16:58 02571_local_desc_abort_on_twitter_json: [ OK ] 1.89 sec.
2026-10-29 02:16:58 02568_json_array_length: [ OK ] 0.53 sec.
2026-10-29 02:16:59 02566_analyzer_limit_settings_distributed: [ OK ] 0.89 sec.
2026-10-29 02:17:01 02565_update_empty_nested: [ OK ] 1.11 sec.
2026-10-29 02:17:01 02567_native_type_conversions: [ OK ] 2.77 sec.
2026-10-29 02:17:01 02564_read_in_order_final_desc: [ OK ] 0.62 sec.
2026-10-29 02:17:02 02570_fallback_from_async_insert: [ OK ] 5.38 sec.
2026-10-29 02:17:04 02563_async_insert_bad_data: [ OK ] 2.84 sec.
2026-10-29 02:17:04 02661_read_from_archive_zip: [ OK ] 15.30 sec.
2026-10-29 02:17:05 02661_read_from_archive_targz: [ OK ] 15.80 sec.
2026-10-29 02:17:05 02560_count_digits: [ OK ] 0.54 sec.
2026-10-29 02:17:05 02661_read_from_archive_tzst: [ OK ] 15.62 sec.
2026-10-29 02:17:05 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.50 sec.
2026-10-29 02:17:05 02764_csv_trim_whitespaces: [ OK ] 30.70 sec.
2026-10-29 02:17:06 02554_invalid_create_view_syntax: [ OK ] 0.33 sec.
2026-10-29 02:17:06 02554_log_faminy_support_storage_policy: [ OK ] 0.60 sec.
2026-10-29 02:17:06 02554_format_json_columns_for_empty: [ OK ] 0.36 sec.
2026-10-29 02:17:06 02553_type_object_analyzer: [ OK ] 0.61 sec.
2026-10-29 02:17:06 02540_duplicate_primary_key2: [ OK ] 0.57 sec.
2026-10-29 02:17:06 02556_local_with_totals_and_extremes: [ OK ] 1.61 sec.
2026-10-29 02:17:07 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.56 sec.
2026-10-29 02:17:07 02538_analyzer_create_table_as_select: [ OK ] 0.46 sec.
2026-10-29 02:17:08 02536_date_from_number_inference_fix: [ OK ] 0.38 sec.
2026-10-29 02:17:08 02538_alter_rename_sequence: [ OK ] 1.26 sec.
2026-10-29 02:17:08 02562_native_tskv_default_for_omitted_fields: [ OK ] 6.72 sec.
2026-10-29 02:17:08 02533_generate_random_schema_inference: [ OK ] 0.38 sec.
2026-10-29 02:17:08 02534_join_prewhere_bug: [ OK ] 0.58 sec.
2026-10-29 02:17:08 02540_date_column_consistent_insert_behaviour: [ OK ] 2.13 sec.
2026-10-29 02:17:09 02561_temporary_table_grants: [ OK ] 6.53 sec.
2026-10-29 02:17:09 02531_ipv4_arithmetic: [ OK ] 0.39 sec.
2026-10-29 02:17:09 02523_range_const_start: [ OK ] 0.51 sec.
2026-10-29 02:17:09 02525_different_engines_in_temporary_tables: [ OK ] 0.96 sec.
2026-10-29 02:17:10 02560_vertical_merge_memory_usage: [ OK ] 6.23 sec.
2026-10-29 02:17:11 02515_aggregate_functions_statistics: [ OK ] 1.09 sec.
2026-10-29 02:17:12 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.45 sec.
2026-10-29 02:17:12 02515_analyzer_null_for_empty: [ OK ] 0.46 sec.
2026-10-29 02:17:13 02534_parquet_fixed_binary_array: [ OK ] 4.87 sec.
2026-10-29 02:17:13 02514_tsv_zero_started_number: [ OK ] 0.35 sec.
2026-10-29 02:17:13 02543_alter_update_rename_stuck: [ OK ] 7.36 sec.
2026-10-29 02:17:13 02513_broken_datetime64_init_on_mac: [ OK ] 0.40 sec.
2026-10-29 02:17:13 02513_prewhere_combine_step_filters: [ OK ] 0.82 sec.
2026-10-29 02:17:13 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 4.52 sec.
2026-10-29 02:17:13 02508_index_analysis_to_date_timezone: [ OK ] 0.51 sec.
2026-10-29 02:17:14 02507_to_unix_timestamp_overflow: [ OK ] 0.51 sec.
2026-10-29 02:17:14 02503_in_lc_const_args_bug: [ OK ] 0.42 sec.
2026-10-29 02:17:14 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.52 sec.
2026-10-29 02:17:14 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.66 sec.
2026-10-29 02:17:14 02500_analyzer_storage_view_crash_fix: [ OK ] 0.55 sec.
2026-10-29 02:17:14 02499_escaped_quote_schema_inference: [ OK ] 0.39 sec.
2026-10-29 02:17:15 02499_analyzer_set_index: [ OK ] 0.48 sec.
2026-10-29 02:17:15 02516_projections_with_rollup: [ OK ] 5.18 sec.
2026-10-29 02:17:15 02703_max_local_read_bandwidth: [ OK ] 29.04 sec.
2026-10-29 02:17:15 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.54 sec.
2026-10-29 02:17:16 02498_random_string_in_json_schema_inference: [ OK ] 1.65 sec.
2026-10-29 02:17:16 02495_concat_with_separator: [ OK ] 1.39 sec.
2026-10-29 02:17:16 02494_parser_string_binary_literal: [ OK ] 0.80 sec.
2026-10-29 02:17:16 02494_array_function_range: [ OK ] 0.48 sec.
2026-10-29 02:17:16 02496_row_binary_large_string_size: [ OK ] 1.88 sec.
2026-10-29 02:17:17 02493_analyzer_sum_if_to_count_if: [ OK ] 0.54 sec.
2026-10-29 02:17:17 02498_storage_join_key_positions: [ OK ] 2.58 sec.
2026-10-29 02:17:19 02491_part_log_has_table_uuid: [ OK ] 2.11 sec.
2026-10-29 02:17:19 02481_i43247_ubsan_in_minmaxany: [ OK ] 1.81 sec.
2026-10-29 02:17:20 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.88 sec.
2026-10-29 02:17:20 02493_inconsistent_hex_and_binary_number: [ OK ] 3.53 sec.
2026-10-29 02:17:20 02481_pk_analysis_with_enum_to_string: [ OK ] 1.68 sec.
2026-10-29 02:17:20 02481_default_value_used_in_row_level_filter: [ OK ] 0.72 sec.
2026-10-29 02:17:21 02480_analyzer_alias_nullptr: [ OK ] 0.41 sec.
2026-10-29 02:17:21 02479_if_with_null_and_cullable_const: [ OK ] 0.40 sec.
2026-10-29 02:17:22 02479_analyzer_aggregation_crash: [ OK ] 0.47 sec.
2026-10-29 02:17:22 02480_tets_show_full: [ OK ] 2.44 sec.
2026-10-29 02:17:22 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.49 sec.
2026-10-29 02:17:22 02479_mysql_connect_to_self: [ OK ] 1.99 sec.
2026-10-29 02:17:23 02477_exists_fuzz_43478: [ OK ] 0.40 sec.
2026-10-29 02:17:23 02477_age: [ OK ] 1.30 sec.
2026-10-29 02:17:24 02493_max_streams_for_merge_tree_reading: [ OK ] 7.60 sec.
2026-10-29 02:17:24 02476_fix_cast_parser_bug: [ OK ] 0.36 sec.
2026-10-29 02:17:24 02475_or_function_alias_and_const_where: [ OK ] 0.39 sec.
2026-10-29 02:17:24 02477_analyzer_array_join_with_join: [ OK ] 1.96 sec.
2026-10-29 02:17:25 02477_invalid_reads: [ OK ] 1.57 sec.
2026-10-29 02:17:25 02474_timeDiff_UTCTimestamp: [ OK ] 0.49 sec.
2026-10-29 02:17:25 02474_extract_fixedstring_from_json: [ OK ] 0.40 sec.
2026-10-29 02:17:25 02474_fix_function_parser_bug: [ OK ] 0.35 sec.
2026-10-29 02:17:25 02521_tsv_csv_custom_header_detection: [ OK ] 16.45 sec.
2026-10-29 02:17:25 02473_extract_low_cardinality_from_json: [ OK ] 0.42 sec.
2026-10-29 02:17:26 02472_segfault_expression_parser: [ OK ] 0.33 sec.
2026-10-29 02:17:26 02471_wrong_date_monotonicity: [ OK ] 0.65 sec.
2026-10-29 02:17:26 02465_limit_trivial_max_rows_to_read: [ OK ] 0.60 sec.
2026-10-29 02:17:26 02476_fuse_sum_count: [ OK ] 2.67 sec.
2026-10-29 02:17:27 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 18.26 sec.
2026-10-29 02:17:27 02461_welch_t_test_fuzz: [ OK ] 0.39 sec.
2026-10-29 02:17:28 02458_empty_hdfs_url: [ OK ] 0.82 sec.
2026-10-29 02:17:31 02458_datediff_date32: [ OK ] 2.85 sec.
2026-10-29 02:17:31 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 5.30 sec.
2026-10-29 02:17:32 02461_alter_update_respect_part_column_type_bug: [ OK ] 5.15 sec.
2026-10-29 02:17:32 02496_remove_redundant_sorting_analyzer: [ OK ] 17.96 sec.
2026-10-29 02:17:33 02457_filesystem_function: [ OK ] 0.76 sec.
2026-10-29 02:17:33 02456_aggregate_state_conversion: [ OK ] 0.58 sec.
2026-10-29 02:17:34 02457_parse_date_time_best_effort: [ OK ] 2.04 sec.
2026-10-29 02:17:35 02456_alter-nullable-column-bag: [ OK ] 2.57 sec.
2026-10-29 02:17:37 02456_test_zero_copy_mutation: [ OK ] 2.07 sec.
2026-10-29 02:17:38 02456_bloom_filter_assert: [ OK ] 4.41 sec.
2026-10-29 02:17:38 02455_extract_fixed_string_from_nested_json: [ OK ] 0.81 sec.
2026-10-29 02:17:39 02454_create_table_with_custom_disk: [ OK ] 0.94 sec.
2026-10-29 02:17:40 02457_morton_coding: [ OK ] 8.93 sec.
2026-10-29 02:17:41 02454_set_parameters_formatting: [ OK ] 2.17 sec.
2026-10-29 02:17:41 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 1.15 sec.
2026-10-29 02:17:42 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 1.78 sec.
2026-10-29 02:17:44 02433_default_expression_operator_in: [ OK ] 1.56 sec.
2026-10-29 02:17:45 02456_async_inserts_logs: [ OK ] 11.42 sec.
2026-10-29 02:17:45 02430_initialize_aggregation_with_combinators: [ OK ] 0.68 sec.
2026-10-29 02:17:46 02429_combinators_in_array_reduce: [ OK ] 0.59 sec.
2026-10-29 02:17:47 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.81 sec.
2026-10-29 02:17:47 02429_low_cardinality_trash: [ OK ] 1.95 sec.
2026-10-29 02:17:47 02426_pod_array_overflow_2: [ OK ] 0.58 sec.
2026-10-29 02:17:48 02426_to_string_nullable_fixedstring: [ OK ] 0.76 sec.
2026-10-29 02:17:48 02426_pod_array_overflow_3: [ OK ] 0.42 sec.
2026-10-29 02:17:50 02426_orc_bug: [ OK ] 2.18 sec.
2026-10-29 02:17:51 02422_read_numbers_as_strings: [ OK ] 0.72 sec.
2026-10-29 02:17:52 02444_async_broken_outdated_part_loading: [ OK ] 11.62 sec.
2026-10-29 02:17:53 02421_json_decimals_as_strings: [ OK ] 0.65 sec.
2026-10-29 02:17:57 02439_merge_selecting_partitions: [ OK ] 16.02 sec.
2026-10-29 02:17:58 02461_cancel_finish_race: [ OK ] 31.39 sec.
2026-10-29 02:17:58 02418_keeper_map_keys_limit: [ OK ] 1.35 sec.
2026-10-29 02:17:58 02416_json_tuple_to_array_schema_inference: [ OK ] 0.35 sec.
2026-10-29 02:17:59 02417_null_variadic_behaviour: [ OK ] 1.10 sec.
2026-10-29 02:17:59 02423_insert_stats_behaviour: [ OK ] 11.37 sec.
2026-10-29 02:17:59 02414_all_new_table_functions_must_be_documented: [ OK ] 0.39 sec.
2026-10-29 02:17:59 02416_rocksdb_delete_update: [ OK ] 0.95 sec.
2026-10-29 02:18:00 02412_nlp: [ OK ] 0.46 sec.
2026-10-29 02:18:00 02394_every_profile_event_must_have_documentation: [ OK ] 0.36 sec.
2026-10-29 02:18:00 02387_parse_date_as_datetime: [ OK ] 0.52 sec.
2026-10-29 02:18:01 02384_analyzer_dict_get_join_get: [ OK ] 0.69 sec.
2026-10-29 02:18:01 02381_analyzer_join_final: [ OK ] 0.99 sec.
2026-10-29 02:18:02 02400_memory_accounting_on_error: [ OK ] 2.31 sec.
2026-10-29 02:18:02 02381_join_dup_columns_in_plan: [ OK ] 1.72 sec.
2026-10-29 02:18:02 02376_analyzer_in_function_subquery: [ OK ] 0.75 sec.
2026-10-29 02:18:03 02375_pretty_formats: [ OK ] 0.69 sec.
2026-10-29 02:18:03 02374_in_tuple_index: [ OK ] 0.80 sec.
2026-10-29 02:18:04 02372_now_in_block: [ OK ] 0.69 sec.
2026-10-29 02:18:10 02380_insert_mv_race: [ OK ] 8.26 sec.
2026-10-29 02:18:11 02367_analyzer_table_alias_columns: [ OK ] 0.59 sec.
2026-10-29 02:18:12 02366_kql_operator_in_sql: [ OK ] 1.07 sec.
2026-10-29 02:18:12 02421_simple_queries_for_opentelemetry: [ OK ] 21.28 sec.
2026-10-29 02:18:12 02366_window_function_order_by: [ OK ] 0.44 sec.
2026-10-29 02:18:13 02366_kql_create_table: [ OK ] 0.93 sec.
2026-10-29 02:18:14 02366_kql_distinct: [ OK ] 0.42 sec.
2026-10-29 02:18:14 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.51 sec.
2026-10-29 02:18:15 02366_kql_func_math: [ OK ] 0.76 sec.
2026-10-29 02:18:16 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.42 sec.
2026-10-29 02:18:16 02366_kql_func_ip: [ OK ] 4.22 sec.
2026-10-29 02:18:18 02359_send_logs_source_regexp: [ OK ] 1.66 sec.
2026-10-29 02:18:20 02361_fsync_profile_events: [ OK ] 4.13 sec.
2026-10-29 02:18:20 02355_column_type_name_lc: [ OK ] 0.33 sec.
2026-10-29 02:18:21 02355_control_block_size_in_array_join: [ OK ] 0.97 sec.
2026-10-29 02:18:22 02370_lost_part_intersecting_merges: [ OK ] 17.59 sec.
2026-10-29 02:18:22 02354_numeric_literals_with_underscores: [ OK ] 0.53 sec.
2026-10-29 02:18:22 02354_window_expression_with_aggregation_expression: [ OK ] 0.89 sec.
2026-10-29 02:18:22 02354_vector_search_bugs: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:18:23 02354_with_statement_non_exist_column: [ OK ] 0.38 sec.
2026-10-29 02:18:23 02354_tuple_element_with_default: [ OK ] 0.77 sec.
2026-10-29 02:18:24 02353_translate: [ OK ] 0.80 sec.
2026-10-29 02:18:24 02372_analyzer_join: [ OK ] 21.08 sec.
2026-10-29 02:18:26 02354_read_in_order_prewhere: [ OK ] 3.21 sec.
2026-10-29 02:18:26 02351_Map_combinator_dist: [ OK ] 1.33 sec.
2026-10-29 02:18:26 02357_query_cancellation_race: [ OK ] 7.63 sec.
2026-10-29 02:18:26 02347_rank_corr_nan: [ OK ] 0.38 sec.
2026-10-29 02:18:26 02352_interactive_queries_from_file: [ OK ] 1.89 sec.
2026-10-29 02:18:26 02346_inverted_index_bug47393: [ OK ] 0.57 sec.
2026-10-29 02:18:27 02346_position_countsubstrings_zero_byte: [ OK ] 0.99 sec.
2026-10-29 02:18:28 02345_filesystem_local: [ OK ] 1.53 sec.
2026-10-29 02:18:28 02345_analyzer_subqueries: [ OK ] 0.97 sec.
2026-10-29 02:18:28 02345_create_table_allow_trailing_comma: [ OK ] 0.50 sec.
2026-10-29 02:18:29 02473_multistep_split_prewhere: [ OK ] 64.37 sec.
2026-10-29 02:18:30 02421_truncate_isolation_no_merges: [ OK ] 36.60 sec.
2026-10-29 02:18:30 02343_group_by_use_nulls: [ OK ] 1.36 sec.
2026-10-29 02:18:30 02340_union_header: [ OK ] 0.47 sec.
2026-10-29 02:18:30 02343_aggregation_pipeline: [ OK ] 1.19 sec.
2026-10-29 02:18:30 02346_into_outfile_and_stdout: [ OK ] 4.11 sec.
2026-10-29 02:18:30 02325_compatibility_setting_2: [ OK ] 0.75 sec.
2026-10-29 02:18:30 02325_dates_schema_inference: [ OK ] 0.67 sec.
2026-10-29 02:18:31 02317_functions_with_nothing: [ OK ] 0.53 sec.
2026-10-29 02:18:31 02337_join_analyze_stuck: [ OK ] 1.48 sec.
2026-10-29 02:18:31 02324_map_combinator_bug: [ OK ] 0.69 sec.
2026-10-29 02:18:31 02319_dict_get_check_arguments_size: [ OK ] 1.23 sec.
2026-10-29 02:18:32 02316_cast_to_ip_address_default_column: [ OK ] 0.60 sec.
2026-10-29 02:18:32 02316_const_string_intersact: [ OK ] 0.86 sec.
2026-10-29 02:18:33 02315_pmj_union_ubsan_35857: [ OK ] 0.41 sec.
2026-10-29 02:18:33 02313_cross_join_dup_col_names: [ OK ] 0.68 sec.
2026-10-29 02:18:33 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 2.22 sec.
2026-10-29 02:18:34 02313_test_fpc_codec: [ OK ] 1.36 sec.
2026-10-29 02:18:34 02311_create_table_with_unknown_format: [ OK ] 0.85 sec.
2026-10-29 02:18:34 02311_range_hashed_dictionary_range_cast: [ OK ] 0.62 sec.
2026-10-29 02:18:34 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 1.10 sec.
2026-10-29 02:18:35 02310_generate_multi_columns_with_uuid: [ OK ] 0.38 sec.
2026-10-29 02:18:35 02306_window_move_row_number_fix: [ OK ] 0.36 sec.
2026-10-29 02:18:35 02304_grouping_set_order_by: [ OK ] 0.46 sec.
2026-10-29 02:18:36 02317_distinct_in_order_optimization: [ OK ] 5.04 sec.
2026-10-29 02:18:36 02302_clash_const_aggegate_join: [ OK ] 0.71 sec.
2026-10-29 02:18:36 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.46 sec.
2026-10-29 02:18:36 02296_nullable_arguments_in_array_filter: [ OK ] 0.50 sec.
2026-10-29 02:18:36 02306_rowbinary_has_no_bom: [ OK ] 1.61 sec.
2026-10-29 02:18:37 02294_system_certificates: [ OK ] 0.45 sec.
2026-10-29 02:18:37 02294_dictionaries_hierarchical_index: [ OK ] 0.64 sec.
2026-10-29 02:18:37 02294_decimal_second_errors: [ OK ] 0.46 sec.
2026-10-29 02:18:37 02301_harmful_reexec: [ OK ] 1.81 sec.
2026-10-29 02:18:38 02295_GROUP_BY_AggregateFunction: [ OK ] 1.77 sec.
2026-10-29 02:18:38 02293_h3_hex_ring: [ OK ] 1.11 sec.
2026-10-29 02:18:38 02293_h3_line: [ OK ] 1.01 sec.
2026-10-29 02:18:39 02291_dictionary_scalar_subquery_reload: [ OK ] 0.99 sec.
2026-10-29 02:18:39 02286_tuple_numeric_identifier: [ OK ] 0.57 sec.
2026-10-29 02:18:39 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:18:39 02280_add_query_level_settings: [ OK ] 0.83 sec.
2026-10-29 02:18:39 02293_grouping_function_group_by: [ OK ] 1.99 sec.
2026-10-29 02:18:39 02276_full_sort_join_unsupported: [ OK ] 0.88 sec.
2026-10-29 02:18:40 02269_to_start_of_interval_overflow: [ OK ] 0.41 sec.
2026-10-29 02:18:40 02267_insert_empty_data: [ OK ] 0.46 sec.
2026-10-29 02:18:41 02267_join_dup_columns_issue36199: [ OK ] 1.29 sec.
2026-10-29 02:18:41 02267_output_format_prometheus: [ OK ] 0.47 sec.
2026-10-29 02:18:43 02267_empty_arrays_read_reverse: [ OK ] 2.56 sec.
2026-10-29 02:18:44 02266_auto_add_nullable: [ OK ] 0.68 sec.
2026-10-29 02:18:45 02267_file_globs_schema_inference: [ OK ] 4.45 sec.
2026-10-29 02:18:45 02265_per_table_ttl_mutation_on_change: [ OK ] 1.23 sec.
2026-10-29 02:18:45 02270_errors_in_files: [ OK ] 6.12 sec.
2026-10-29 02:18:47 02260_alter_compact_part_drop_nested_column: [ OK ] 1.15 sec.
2026-10-29 02:18:50 02250_lots_of_columns_in_csv_with_names: [ OK ] 3.78 sec.
2026-10-29 02:18:52 02317_distinct_in_order_optimization_explain: [ OK ] 21.29 sec.
2026-10-29 02:18:53 02263_format_insert_settings: [ OK ] 7.28 sec.
2026-10-29 02:18:53 02246_flatten_tuple: [ OK ] 0.96 sec.
2026-10-29 02:18:54 02245_s3_schema_desc: [ OK ] 0.93 sec.
2026-10-29 02:18:54 02346_read_in_order_fixed_prefix: [ OK ] 28.08 sec.
2026-10-29 02:18:54 02473_multistep_prewhere: [ OK ] 89.53 sec.
2026-10-29 02:18:54 02255_broken_parts_chain_on_start: [ OK ] 8.96 sec.
2026-10-29 02:18:54 02245_s3_virtual_columns: [ OK ] 0.85 sec.
2026-10-29 02:18:55 02243_make_date32_mysql: [ OK ] 0.62 sec.
2026-10-29 02:18:55 02243_in_ip_address: [ OK ] 0.58 sec.
2026-10-29 02:18:55 02245_make_datetime64: [ OK ] 1.83 sec.
2026-10-29 02:18:55 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.45 sec.
2026-10-29 02:18:56 02242_make_date_mysql: [ OK ] 0.99 sec.
2026-10-29 02:18:56 02241_short_circuit_short_column: [ OK ] 0.42 sec.
2026-10-29 02:18:56 02240_get_type_serialization_streams: [ OK ] 0.40 sec.
2026-10-29 02:18:56 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.41 sec.
2026-10-29 02:18:56 02234_position_case_insensitive_utf8: [ OK ] 0.62 sec.
2026-10-29 02:18:56 02233_with_total_empty_chunk: [ OK ] 0.63 sec.
2026-10-29 02:18:56 02243_make_date32: [ OK ] 1.84 sec.
2026-10-29 02:18:56 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.57 sec.
2026-10-29 02:18:57 02227_union_match_by_name: [ OK ] 0.39 sec.
2026-10-29 02:18:58 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 1.55 sec.
2026-10-29 02:18:58 02226_low_cardinality_text_bloom_filter_index: [ OK ] 1.99 sec.
2026-10-29 02:18:59 02235_add_part_offset_virtual_column: [ OK ] 3.58 sec.
2026-10-29 02:19:00 02212_h3_get_pentagon_indexes: [ OK ] 0.74 sec.
2026-10-29 02:19:00 02225_hints_for_indeices: [ OK ] 3.60 sec.
2026-10-29 02:19:01 02481_async_insert_dedup: [ OK ] 104.38 sec.
2026-10-29 02:19:02 02206_clickhouse_local_use_database: [ OK ] 1.62 sec.
2026-10-29 02:19:03 02221_system_zookeeper_unrestricted_like: [ OK ] 4.99 sec.
2026-10-29 02:19:03 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:19:03 02207_s3_content_type: [ OK ] 2.87 sec.
2026-10-29 02:19:04 02201_use_skip_indexes_if_final: [ OK ] 0.55 sec.
2026-10-29 02:19:04 02205_postgresql_functions: [ OK ] 1.61 sec.
2026-10-29 02:19:04 02229_client_stop_multiquery_in_SIGINT: [ OK ] 7.65 sec.
2026-10-29 02:19:04 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.54 sec.
2026-10-29 02:19:04 02206_format_override: [ OK ] 2.69 sec.
2026-10-29 02:19:04 02221_parallel_replicas_bug: [ OK ] 5.92 sec.
2026-10-29 02:19:04 02177_issue_31009: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:19:04 02184_ipv6_cast_test: [ OK ] 0.48 sec.
2026-10-29 02:19:04 02246_is_secure_query_log: [ OK ] 13.96 sec.
2026-10-29 02:19:05 02203_shebang: [ OK ] 1.63 sec.
2026-10-29 02:19:05 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.88 sec.
2026-10-29 02:19:05 02180_group_by_lowcardinality: [ OK ] 0.43 sec.
2026-10-29 02:19:05 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.95 sec.
2026-10-29 02:19:05 02176_optimize_aggregation_in_order_empty: [ OK ] 0.88 sec.
2026-10-29 02:19:05 02177_merge_optimize_aggregation_in_order: [ OK ] 0.91 sec.
2026-10-29 02:19:05 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.91 sec.
2026-10-29 02:19:05 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:19:05 02165_h3_edge_length_km: [ OK ] 0.68 sec.
2026-10-29 02:19:06 02163_operators: [ OK ] 0.39 sec.
2026-10-29 02:19:06 02165_h3_num_hexagons: [ OK ] 0.68 sec.
2026-10-29 02:19:06 02162_array_first_last_index: [ OK ] 0.76 sec.
2026-10-29 02:19:06 02158_ztest: [ OK ] 0.71 sec.
2026-10-29 02:19:06 02176_dict_get_has_implicit_key_cast: [ OK ] 1.55 sec.
2026-10-29 02:19:06 02160_special_functions: [ OK ] 0.91 sec.
2026-10-29 02:19:07 02155_parse_date_lowcard_default_throw: [ OK ] 0.35 sec.
2026-10-29 02:19:07 02155_dictionary_comment: [ OK ] 0.81 sec.
2026-10-29 02:19:07 02174_cte_scalar_cache: [ OK ] 2.35 sec.
2026-10-29 02:19:07 02150_replace_regexp_all_empty_match: [ OK ] 0.36 sec.
2026-10-29 02:19:08 02149_issue_32487: [ OK ] 0.39 sec.
2026-10-29 02:19:08 02157_readonly_system_suspend: [ OK ] 1.97 sec.
2026-10-29 02:19:08 02148_cast_type_parsing: [ OK ] 0.42 sec.
2026-10-29 02:19:08 02158_proportions_ztest_cmp: [ OK ] 2.60 sec.
2026-10-29 02:19:09 02158_ztest_cmp: [ OK ] 2.60 sec.
2026-10-29 02:19:09 02147_order_by_optimizations: [ OK ] 0.43 sec.
2026-10-29 02:19:09 02154_bit_slice_for_fixedstring: [ OK ] 2.36 sec.
2026-10-29 02:19:09 02151_client_option_echo: [ OK ] 2.79 sec.
2026-10-29 02:19:10 02136_scalar_progress: [ OK ] 1.57 sec.
2026-10-29 02:19:10 02271_replace_partition_many_tables: [ OK ] 31.06 sec.
2026-10-29 02:19:10 02141_clickhouse_local_interactive_table: [ OK ] 1.96 sec.
2026-10-29 02:19:10 02135_local_create_db: [ OK ] 1.84 sec.
2026-10-29 02:19:11 02129_add_column_add_ttl: [ OK ] 1.20 sec.
2026-10-29 02:19:11 02128_apply_lambda_parsing: [ OK ] 0.37 sec.
2026-10-29 02:19:11 02129_window_functions_disable_optimizations: [ OK ] 0.51 sec.
2026-10-29 02:19:11 02136_kill_scalar_queries: [ OK ] 2.25 sec.
2026-10-29 02:19:11 02128_cast_nullable: [ OK ] 0.42 sec.
2026-10-29 02:19:11 02125_dict_get_type_nullable_fix: [ OK ] 0.67 sec.
2026-10-29 02:19:12 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.72 sec.
2026-10-29 02:19:12 02126_url_auth: [ OK ] 1.86 sec.
2026-10-29 02:19:13 02124_insert_deduplication_token_replica: [ OK ] 1.23 sec.
2026-10-29 02:19:17 02124_insert_deduplication_token_materialized_views: [ OK ] 6.14 sec.
2026-10-29 02:19:18 02134_async_inserts_formats: [ OK ] 8.75 sec.
2026-10-29 02:19:20 02122_parallel_formatting_Vertical: [ OK ] 8.31 sec.
2026-10-29 02:19:21 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 8.11 sec.
2026-10-29 02:19:22 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 11.10 sec.
2026-10-29 02:19:22 02122_parallel_formatting_TSV: [ OK ] 9.66 sec.
2026-10-29 02:19:23 02122_parallel_formatting_JSONCompact: [ OK ] 5.18 sec.
2026-10-29 02:19:23 02122_parallel_formatting_CustomSeparated: [ OK ] 5.85 sec.
2026-10-29 02:19:23 02113_untuple_func_alias: [ OK ] 0.60 sec.
2026-10-29 02:19:24 02112_skip_index_set_and_or: [ OK ] 0.41 sec.
2026-10-29 02:19:25 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 1.85 sec.
2026-10-29 02:19:25 02125_lz4_compression_bug_Values: [ OK ] 14.61 sec.
2026-10-29 02:19:26 02112_delayed_clickhouse_local: [ OK ] 1.74 sec.
2026-10-29 02:19:26 02104_clickhouse_local_columns_description: [ OK ] 1.39 sec.
2026-10-29 02:19:27 02097_initializeAggregationNullable: [ OK ] 0.64 sec.
2026-10-29 02:19:27 02097_polygon_dictionary_store_key: [ OK ] 1.74 sec.
2026-10-29 02:19:27 02122_parallel_formatting_Values: [ OK ] 6.10 sec.
2026-10-29 02:19:27 02122_parallel_formatting_Markdown: [ OK ] 5.40 sec.
2026-10-29 02:19:27 02096_totals_global_in_bug: [ OK ] 0.44 sec.
2026-10-29 02:19:27 02095_function_get_os_kernel_version: [ OK ] 0.32 sec.
2026-10-29 02:19:28 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.51 sec.
2026-10-29 02:19:28 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.48 sec.
2026-10-29 02:19:28 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 7.97 sec.
2026-10-29 02:19:28 02045_like_function: [ OK ] 0.44 sec.
2026-10-29 02:19:29 02041_openssl_hash_functions_test: [ OK ] 0.72 sec.
2026-10-29 02:19:29 02041_test_fuzzy_alter: [ OK ] 0.64 sec.
2026-10-29 02:19:29 02043_query_obfuscator_embedded_dictionaries: [ OK ] 1.37 sec.
2026-10-29 02:19:29 02049_clickhouse_local_merge_tree: [ OK ] 1.93 sec.
2026-10-29 02:19:30 02096_bad_options_in_client_and_local: [ OK ] 2.76 sec.
2026-10-29 02:19:30 02029_quantile_sanitizer: [ OK ] 0.63 sec.
2026-10-29 02:19:30 02030_function_mapContainsKeyLike: [ OK ] 1.01 sec.
2026-10-29 02:19:30 02026_arrayDifference_const: [ OK ] 0.35 sec.
2026-10-29 02:19:30 02030_client_unknown_database: [ OK ] 1.56 sec.
2026-10-29 02:19:30 02027_ngrams: [ OK ] 0.75 sec.
2026-10-29 02:19:32 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 1.64 sec.
2026-10-29 02:19:32 02025_subcolumns_compact_parts: [ OK ] 2.12 sec.
2026-10-29 02:19:32 02026_accurate_cast_or_default: [ OK ] 2.18 sec.
2026-10-29 02:19:34 02033_join_engine_deadlock_long: [ OK ] 5.12 sec.
2026-10-29 02:19:34 02020_cast_integer_overflow: [ OK ] 0.39 sec.
2026-10-29 02:19:35 02021_map_bloom_filter_index: [ OK ] 2.80 sec.
2026-10-29 02:19:36 02024_compression_in_query: [ OK ] 5.48 sec.
2026-10-29 02:19:37 02021_exponential_sum_shard: [ OK ] 4.62 sec.
2026-10-29 02:19:38 02020_exponential_smoothing: [ OK ] 5.95 sec.
2026-10-29 02:19:38 02016_aggregation_spark_bar: [ OK ] 4.07 sec.
2026-10-29 02:19:38 02015_async_inserts_2: [ OK ] 2.36 sec.
2026-10-29 02:19:39 02016_bit_shift_right_for_string_integer: [ OK ] 3.42 sec.
2026-10-29 02:19:39 02012_sha512_fixedstring: [ OK ] 0.64 sec.
2026-10-29 02:19:40 02047_log_family_complex_structs_data_file_dumps: [ OK ] 11.99 sec.
2026-10-29 02:19:40 02013_json_function_null_column: [ OK ] 1.02 sec.
2026-10-29 02:19:41 02012_compress_lz4: [ OK ] 2.40 sec.
2026-10-29 02:19:41 02008_test_union_distinct_in_subquery: [ OK ] 1.34 sec.
2026-10-29 02:19:41 02011_normalize_utf8: [ OK ] 1.78 sec.
2026-10-29 02:19:41 02006_client_test_hint_error_name: [ OK ] 0.38 sec.
2026-10-29 02:19:42 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.75 sec.
2026-10-29 02:19:42 02013_zlib_read_after_eof: [ OK ] 3.66 sec.
2026-10-29 02:19:42 02122_4letter_words_stress_zookeeper: [ OK ] 20.03 sec.
2026-10-29 02:19:43 02000_table_function_cluster_macros: [ OK ] 0.83 sec.
2026-10-29 02:19:43 02011_tuple_vector_functions: [ OK ] 3.73 sec.
2026-10-29 02:19:43 02150_index_hypothesis_race_long: [ OK ] 36.46 sec.
2026-10-29 02:19:44 01960_lambda_precedence: [ OK ] 0.45 sec.
2026-10-29 02:19:44 02002_system_table_with_tuple: [ OK ] 1.72 sec.
2026-10-29 02:19:44 02001_append_output_file: [ OK ] 2.03 sec.
2026-10-29 02:19:44 01951_distributed_push_down_limit: [ OK ] 0.70 sec.
2026-10-29 02:19:44 02015_async_inserts_4: [ OK ] 7.64 sec.
2026-10-29 02:19:44 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.73 sec.
2026-10-29 02:19:45 01942_untuple_transformers_msan: [ OK ] 0.49 sec.
2026-10-29 02:19:45 02004_intersect_except_distinct_operators: [ OK ] 4.09 sec.
2026-10-29 02:19:45 01949_heredoc_unfinished: [ OK ] 1.70 sec.
2026-10-29 02:19:45 01944_insert_partition_by: [ OK ] 1.24 sec.
2026-10-29 02:19:45 01940_totimezone_operator_monotonicity: [ OK ] 0.89 sec.
2026-10-29 02:19:46 01938_joins_identifiers: [ OK ] 0.56 sec.
2026-10-29 02:19:46 01937_nested_chinese: [ OK ] 0.49 sec.
2026-10-29 02:19:46 01926_union_all_schmak: [ OK ] 0.39 sec.
2026-10-29 02:19:46 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 2.85 sec.
2026-10-29 02:19:46 01926_date_date_time_supertype: [ OK ] 0.64 sec.
2026-10-29 02:19:47 01935_parametrized_query_parametric_aggregate_function: [ OK ] 1.30 sec.
2026-10-29 02:19:47 01925_json_as_string_data_in_square_brackets: [ OK ] 0.54 sec.
2026-10-29 02:19:47 01922_array_join_with_index: [ OK ] 0.40 sec.
2026-10-29 02:19:47 01925_jit_aggregation_function_count_long: [ OK ] 0.74 sec.
2026-10-29 02:19:47 01914_ubsan_quantile_timing: [ OK ] 0.42 sec.
2026-10-29 02:19:47 01913_names_of_tuple_literal: [ OK ] 0.43 sec.
2026-10-29 02:19:47 01921_with_fill_with_totals: [ OK ] 0.69 sec.
2026-10-29 02:19:48 01921_test_progress_bar: [ OK ] 0.69 sec.
2026-10-29 02:19:48 01906_partition_by_multiply_by_zero: [ OK ] 0.91 sec.
2026-10-29 02:19:49 01906_bigint_accurate_cast_ubsan: [ OK ] 1.22 sec.
2026-10-29 02:19:49 01927_query_views_log_current_database: [ OK ] 3.40 sec.
2026-10-29 02:19:49 01901_in_literal_shard_prune: [ OK ] 0.69 sec.
2026-10-29 02:19:49 01902_table_function_merge_db_params: [ OK ] 0.96 sec.
2026-10-29 02:19:50 01903_http_fields: [ OK ] 2.81 sec.
2026-10-29 02:19:51 01943_query_id_check: [ OK ] 6.32 sec.
2026-10-29 02:19:51 01892_setting_limit_offset_distributed: [ OK ] 1.57 sec.
2026-10-29 02:19:51 01891_partition_by_uuid: [ OK ] 0.72 sec.
2026-10-29 02:19:52 01890_state_of_state: [ OK ] 1.32 sec.
2026-10-29 02:19:53 01882_scalar_subquery_exception: [ OK ] 0.74 sec.
2026-10-29 02:19:55 01882_check_max_parts_to_merge_at_once: [ OK ] 3.97 sec.
2026-10-29 02:19:55 01882_total_rows_approx: [ OK ] 4.02 sec.
2026-10-29 02:19:56 02003_memory_limit_in_client: [ OK ] 14.35 sec.
2026-10-29 02:19:56 01881_create_as_tuple: [ OK ] 0.55 sec.
2026-10-29 02:19:56 01881_to_week_monotonic_fix: [ OK ] 0.90 sec.
2026-10-29 02:19:57 01880_materialized_view_to_table_type_check: [ OK ] 0.89 sec.
2026-10-29 02:19:57 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.35 sec.
2026-10-29 02:19:57 01880_remote_ipv6: [ OK ] 0.80 sec.
2026-10-29 02:19:57 01852_s2_get_neighbours: [ OK ] 0.44 sec.
2026-10-29 02:19:58 01851_s2_to_geo: [ OK ] 0.34 sec.
2026-10-29 02:19:58 01866_datetime64_cmp_with_constant: [ OK ] 1.62 sec.
2026-10-29 02:19:58 01851_hedged_connections_external_tables: [ OK ] 0.47 sec.
2026-10-29 02:19:59 01851_clear_column_referenced_by_mv: [ OK ] 0.85 sec.
2026-10-29 02:19:59 01866_view_persist_settings: [ OK ] 2.48 sec.
2026-10-29 02:19:59 01881_join_on_conditions_hash: [ OK ] 6.28 sec.
2026-10-29 02:20:00 01846_alter_column_without_type_bugfix: [ OK ] 0.39 sec.
2026-10-29 02:20:00 01894_jit_aggregation_function_max_long: [ OK ] 10.69 sec.
2026-10-29 02:20:00 01849_geoToS2: [ OK ] 1.25 sec.
2026-10-29 02:20:00 01837_cast_to_array_from_empty_array: [ OK ] 0.65 sec.
2026-10-29 02:20:00 01845_add_testcase_for_arrayElement: [ OK ] 0.91 sec.
2026-10-29 02:20:00 01838_system_dictionaries_virtual_key_column: [ OK ] 0.95 sec.
2026-10-29 02:20:00 01831_max_streams: [ OK ] 0.38 sec.
2026-10-29 02:20:01 01893_jit_aggregation_function_min_long: [ OK ] 11.20 sec.
2026-10-29 02:20:01 01825_type_json_18: [ OK ] 0.49 sec.
2026-10-29 02:20:02 01834_alias_columns_laziness_filimonov: [ OK ] 2.64 sec.
2026-10-29 02:20:03 01825_type_json_missed_values: [ OK ] 1.09 sec.
2026-10-29 02:20:04 01825_type_json_15: [ OK ] 3.89 sec.
2026-10-29 02:20:05 01825_type_json_7: [ OK ] 3.67 sec.
2026-10-29 02:20:05 01825_type_json_13: [ OK ] 4.31 sec.
2026-10-29 02:20:06 01825_type_json_mutations: [ OK ] 1.02 sec.
2026-10-29 02:20:07 01821_join_table_mutation: [ OK ] 1.22 sec.
2026-10-29 02:20:07 01825_type_json_3: [ OK ] 2.72 sec.
2026-10-29 02:20:07 01818_case_float_value_fangyc: [ OK ] 0.33 sec.
2026-10-29 02:20:07 01817_storage_buffer_parameters: [ OK ] 0.45 sec.
2026-10-29 02:20:08 01813_quantileBfloat16_nans: [ OK ] 0.40 sec.
2026-10-29 02:20:08 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.61 sec.
2026-10-29 02:20:08 01926_order_by_desc_limit: [ OK ] 22.70 sec.
2026-10-29 02:20:09 01804_uniq_up_to_ubsan: [ OK ] 0.38 sec.
2026-10-29 02:20:09 01802_toDateTime64_large_values: [ OK ] 0.47 sec.
2026-10-29 02:20:09 01802_formatDateTime_DateTime64_century: [ OK ] 0.62 sec.
2026-10-29 02:20:09 01822_short_circuit: [ OK ] 4.58 sec.
2026-10-29 02:20:10 01798_having_push_down: [ OK ] 0.58 sec.
2026-10-29 02:20:10 01795_TinyLog_rwlock_ub: [ OK ] 0.52 sec.
2026-10-29 02:20:10 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.76 sec.
2026-10-29 02:20:11 01787_arena_assert_column_nothing: [ OK ] 0.36 sec.
2026-10-29 02:20:11 01791_dist_INSERT_block_structure_mismatch: [ OK ] 2.02 sec.
2026-10-29 02:20:11 01811_storage_buffer_flush_parameters: [ OK ] 3.57 sec.
2026-10-29 02:20:12 01788_update_nested_type_subcolumn_check: [ OK ] 2.08 sec.
2026-10-29 02:20:12 01785_pmj_lc_bug: [ OK ] 1.03 sec.
2026-10-29 02:20:13 01910_view_dictionary_check_refresh: [ OK ] 25.27 sec.
2026-10-29 02:20:13 01780_range_msan: [ OK ] 0.35 sec.
2026-10-29 02:20:13 01774_tuple_null_in: [ OK ] 0.60 sec.
2026-10-29 02:20:13 01784_parallel_formatting_memory: [ OK ] 2.03 sec.
2026-10-29 02:20:14 01774_case_sensitive_connection_id: [ OK ] 0.47 sec.
2026-10-29 02:20:14 01825_type_json_nbagames: [ OK ] 12.95 sec.
2026-10-29 02:20:14 01773_datetime64_add_ubsan: [ OK ] 0.41 sec.
2026-10-29 02:20:14 01770_extended_range_3: [ OK ] 0.75 sec.
2026-10-29 02:20:14 01773_min_max_time_system_parts_datetime64: [ OK ] 0.92 sec.
2026-10-29 02:20:14 01769_extended_range_2: [ OK ] 0.55 sec.
2026-10-29 02:20:14 01772_to_start_of_hour_align: [ OK ] 0.88 sec.
2026-10-29 02:20:15 01780_column_sparse_full: [ OK ] 2.59 sec.
2026-10-29 02:20:15 01825_type_json_ghdata: [ OK ] 11.36 sec.
2026-10-29 02:20:15 01785_parallel_formatting_memory: [ OK ] 3.87 sec.
2026-10-29 02:20:15 01755_shard_pruning_with_literal: [ OK ] 0.41 sec.
2026-10-29 02:20:15 01762_deltasumtimestamp: [ OK ] 0.60 sec.
2026-10-29 02:20:15 01753_mutate_table_predicated_with_table: [ OK ] 0.71 sec.
2026-10-29 02:20:15 01720_union_distinct_with_limit: [ OK ] 0.39 sec.
2026-10-29 02:20:16 01720_engine_file_empty_if_not_exists: [ OK ] 0.44 sec.
2026-10-29 02:20:16 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 1.24 sec.
2026-10-29 02:20:16 01714_alter_drop_version: [ OK ] 0.82 sec.
2026-10-29 02:20:16 01753_optimize_aggregation_in_order: [ OK ] 1.85 sec.
2026-10-29 02:20:16 01750_parsing_exception: [ OK ] 1.78 sec.
2026-10-29 02:20:17 01710_projection_in_set: [ OK ] 0.85 sec.
2026-10-29 02:20:17 01710_projection_with_mixed_pipeline: [ OK ] 0.45 sec.
2026-10-29 02:20:17 01710_projection_with_column_transformers: [ OK ] 0.44 sec.
2026-10-29 02:20:17 01710_projections_group_by_no_key: [ OK ] 0.78 sec.
2026-10-29 02:20:17 01710_projection_optimize_group_by_function_keys: [ OK ] 0.65 sec.
2026-10-29 02:20:18 01710_projection_external_aggregate: [ OK ] 1.34 sec.
2026-10-29 02:20:18 01710_projection_drop_if_exists: [ OK ] 0.57 sec.
2026-10-29 02:20:19 01710_minmax_count_projection_distributed_query: [ OK ] 1.18 sec.
2026-10-29 02:20:19 01710_normal_projection_format: [ OK ] 0.36 sec.
2026-10-29 02:20:19 01731_async_task_queue_wait: [ OK ] 3.80 sec.
2026-10-29 02:20:19 01710_projection_optimize_materialize: [ OK ] 2.48 sec.
2026-10-29 02:20:19 01710_projection_with_nullable_keys: [ OK ] 0.54 sec.
2026-10-29 02:20:19 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.55 sec.
2026-10-29 02:20:20 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.39 sec.
2026-10-29 02:20:20 01710_query_log_with_projection_info: [ OK ] 3.30 sec.
2026-10-29 02:20:20 01700_system_zookeeper_path_in: [ OK ] 0.98 sec.
2026-10-29 02:20:20 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 1.06 sec.
2026-10-29 02:20:21 01690_quantilesTiming_ubsan: [ OK ] 0.40 sec.
2026-10-29 02:20:21 01825_type_json_ghdata_insert_select: [ OK ] 20.54 sec.
2026-10-29 02:20:21 01699_timezoneOffset: [ OK ] 1.65 sec.
2026-10-29 02:20:21 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.67 sec.
2026-10-29 02:20:21 01683_intdiv_ubsan: [ OK ] 0.46 sec.
2026-10-29 02:20:22 01686_rocksdb: [ OK ] 1.24 sec.
2026-10-29 02:20:22 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.78 sec.
2026-10-29 02:20:22 01680_date_time_add_ubsan: [ OK ] 1.07 sec.
2026-10-29 02:20:23 01681_bloom_filter_nullable_column: [ OK ] 1.38 sec.
2026-10-29 02:20:23 01678_great_circle_angle: [ OK ] 0.42 sec.
2026-10-29 02:20:23 01671_aggregate_function_group_bitmap_data: [ OK ] 0.64 sec.
2026-10-29 02:20:23 01670_distributed_bytes_to_throw_insert: [ OK ] 0.58 sec.
2026-10-29 02:20:24 01670_test_repeat_mysql_dialect: [ OK ] 0.41 sec.
2026-10-29 02:20:24 01681_hyperscan_debug_assertion: [ OK ] 2.69 sec.
2026-10-29 02:20:24 01674_clickhouse_client_query_param_cte: [ OK ] 1.77 sec.
2026-10-29 02:20:24 01669_test_toYear_mysql_dialect: [ OK ] 0.37 sec.
2026-10-29 02:20:24 01668_avg_weighted_ubsan: [ OK ] 0.45 sec.
2026-10-29 02:20:25 01691_parser_data_type_exponential: [ OK ] 4.67 sec.
2026-10-29 02:20:25 01670_log_comment: [ OK ] 1.09 sec.
2026-10-29 02:20:25 01663_test_toDate_mysql_compatibility: [ OK ] 0.43 sec.
2026-10-29 02:20:25 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.49 sec.
2026-10-29 02:20:25 01663_quantile_weighted_overflow: [ OK ] 0.66 sec.
2026-10-29 02:20:25 01666_lcm_ubsan: [ OK ] 1.02 sec.
2026-10-29 02:20:26 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.43 sec.
2026-10-29 02:20:26 01657_test_toHour_mysql_compatibility: [ OK ] 0.42 sec.
2026-10-29 02:20:26 01657_array_element_ubsan: [ OK ] 0.85 sec.
2026-10-29 02:20:27 01656_ipv4_bad_formatting: [ OK ] 0.45 sec.
2026-10-29 02:20:27 01661_week_functions_string_args: [ OK ] 1.63 sec.
2026-10-29 02:20:27 01655_agg_if_nullable: [ OK ] 0.42 sec.
2026-10-29 02:20:27 01652_ttl_old_syntax: [ OK ] 0.53 sec.
2026-10-29 02:20:28 01655_window_functions_bug: [ OK ] 1.13 sec.
2026-10-29 02:20:28 01660_join_or_all: [ OK ] 2.61 sec.
2026-10-29 02:20:28 01651_group_uniq_array_enum: [ OK ] 0.37 sec.
2026-10-29 02:20:28 01650_expressions_merge_bug: [ OK ] 0.43 sec.
2026-10-29 02:20:29 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.72 sec.
2026-10-29 02:20:29 01640_distributed_async_insert_compression: [ OK ] 0.75 sec.
2026-10-29 02:20:30 01646_rewrite_sum_if: [ OK ] 2.16 sec.
2026-10-29 02:20:31 01631_date_overflow_as_partition_key: [ OK ] 0.83 sec.
2026-10-29 02:20:31 01710_projections_optimize_aggregation_in_order: [ OK ] 12.57 sec.
2026-10-29 02:20:31 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 13.77 sec.
2026-10-29 02:20:32 01623_byte_size_const: [ OK ] 0.38 sec.
2026-10-29 02:20:32 01626_cnf_test: [ OK ] 0.45 sec.
2026-10-29 02:20:32 01616_untuple_access_field: [ OK ] 0.36 sec.
2026-10-29 02:20:32 01648_mutations_and_escaping: [ OK ] 4.14 sec.
2026-10-29 02:20:32 01610_client_spawn_editor: [ OK ] 0.22 sec.
2026-10-29 02:20:33 01620_fix_simple_state_arg_type: [ OK ] 0.90 sec.
2026-10-29 02:20:33 01615_two_args_function_index_fix: [ OK ] 0.47 sec.
2026-10-29 02:20:33 01605_key_condition_enum_int: [ OK ] 0.48 sec.
2026-10-29 02:20:33 01621_clickhouse_compressor: [ OK ] 1.74 sec.
2026-10-29 02:20:33 01605_drop_settings_profile_while_assigned: [ OK ] 0.50 sec.
2026-10-29 02:20:33 01605_skip_idx_compact_parts: [ OK ] 0.74 sec.
2026-10-29 02:20:33 01600_encode_XML: [ OK ] 0.36 sec.
2026-10-29 02:20:34 01600_min_max_compress_block_size: [ OK ] 0.43 sec.
2026-10-29 02:20:34 01592_length_map: [ OK ] 0.37 sec.
2026-10-29 02:20:34 01592_toUnixTimestamp_Date: [ OK ] 0.39 sec.
2026-10-29 02:20:34 01601_proxy_protocol: [ OK ] 1.35 sec.
2026-10-29 02:20:34 01585_fuzz_bits_with_bugfix: [ OK ] 0.44 sec.
2026-10-29 02:20:35 01585_use_index_for_global_in: [ OK ] 0.57 sec.
2026-10-29 02:20:35 01666_merge_tree_max_query_limit: [ OK ] 10.94 sec.
2026-10-29 02:20:36 01580_column_const_comparision: [ OK ] 0.98 sec.
2026-10-29 02:20:36 01581_deduplicate_by_columns_replicated_long: [ OK ] 2.06 sec.
2026-10-29 02:20:37 01562_optimize_monotonous_functions_in_order_by: [ OK ] 0.96 sec.
2026-10-29 02:20:38 01581_deduplicate_by_columns_local: [ OK ] 3.39 sec.
2026-10-29 02:20:38 01553_datetime64_comparison: [ OK ] 0.36 sec.
2026-10-29 02:20:38 01562_agg_null_for_empty_ahead: [ OK ] 0.83 sec.
2026-10-29 02:20:38 01576_alias_column_rewrite: [ OK ] 3.09 sec.
2026-10-29 02:20:39 01552_dict_fixedstring: [ OK ] 0.52 sec.
2026-10-29 02:20:39 01551_mergetree_read_in_order_spread: [ OK ] 0.51 sec.
2026-10-29 02:20:39 01550_mutation_subquery: [ OK ] 0.78 sec.
2026-10-29 02:20:39 01549_low_cardinality_materialized_view: [ OK ] 0.73 sec.
2026-10-29 02:20:39 01549_low_cardinality_mv_fuzz: [ OK ] 0.52 sec.
2026-10-29 02:20:40 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 6.41 sec.
2026-10-29 02:20:40 01548_uncomparable_columns_in_keys: [ OK ] 0.47 sec.
2026-10-29 02:20:41 01532_collate_in_low_cardinality: [ OK ] 0.62 sec.
2026-10-29 02:20:41 01548_create_table_compound_column_format: [ OK ] 1.42 sec.
2026-10-29 02:20:41 01632_tinylog_read_write: [ OK ] 12.05 sec.
2026-10-29 02:20:41 01532_tuple_with_name_type: [ OK ] 0.84 sec.
2026-10-29 02:20:42 01544_file_engine_settings: [ OK ] 2.01 sec.
2026-10-29 02:20:42 01527_bad_aggregation_in_lambda: [ OK ] 0.49 sec.
2026-10-29 02:20:42 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.75 sec.
2026-10-29 02:20:42 01528_to_uuid_or_null_or_zero: [ OK ] 1.01 sec.
2026-10-29 02:20:43 01525_select_with_offset_fetch_clause: [ OK ] 0.44 sec.
2026-10-29 02:20:43 01576_if_null_external_aggregation: [ OK ] 7.00 sec.
2026-10-29 02:20:43 01521_alter_enum_and_reverse_read: [ OK ] 0.69 sec.
2026-10-29 02:20:43 01547_query_log_current_database: [ OK ] 3.99 sec.
2026-10-29 02:20:44 01521_format_readable_time_delta2: [ OK ] 0.59 sec.
2026-10-29 02:20:44 01526_param_uuid: [ OK ] 1.78 sec.
2026-10-29 02:20:44 01514_empty_buffer_different_types: [ OK ] 0.61 sec.
2026-10-29 02:20:45 01521_max_length_alias: [ OK ] 1.25 sec.
2026-10-29 02:20:45 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.76 sec.
2026-10-29 02:20:45 01655_plan_optimizations: [ OK ] 18.48 sec.
2026-10-29 02:20:45 01520_client_print_query_id: [ OK ] 1.71 sec.
2026-10-29 02:20:45 01531_query_log_query_comment: [ OK ] 4.40 sec.
2026-10-29 02:20:46 01508_explain_header: [ OK ] 0.32 sec.
2026-10-29 02:20:46 01523_client_local_queries_file_parameter: [ OK ] 3.27 sec.
2026-10-29 02:20:47 01505_trivial_count_with_partition_predicate: [ OK ] 1.31 sec.
2026-10-29 02:20:47 01508_query_obfuscator: [ OK ] 1.76 sec.
2026-10-29 02:20:47 01509_format_raw_blob: [ OK ] 2.74 sec.
2026-10-29 02:20:47 01508_format_regexp_raw: [ OK ] 2.42 sec.
2026-10-29 02:20:47 01505_log_distributed_deadlock: [ OK ] 0.39 sec.
2026-10-29 02:20:48 01499_log_deadlock: [ OK ] 0.53 sec.
2026-10-29 02:20:48 01498_alter_column_storage_memory: [ OK ] 0.38 sec.
2026-10-29 02:20:48 01496_signedness_conversion_monotonicity: [ OK ] 0.54 sec.
2026-10-29 02:20:48 01493_table_function_null: [ OK ] 0.38 sec.
2026-10-29 02:20:48 01492_array_join_crash_13829: [ OK ] 0.35 sec.
2026-10-29 02:20:48 01492_format_readable_quantity: [ OK ] 0.42 sec.
2026-10-29 02:20:49 01474_decimal_scale_bug: [ OK ] 0.70 sec.
2026-10-29 02:20:49 01483_merge_table_join_and_group_by: [ OK ] 1.09 sec.
2026-10-29 02:20:50 01471_with_format: [ OK ] 0.46 sec.
2026-10-29 02:20:50 01471_top_k_range_check: [ OK ] 0.53 sec.
2026-10-29 02:20:50 01477_lc_in_merge_join_left_key: [ OK ] 2.06 sec.
2026-10-29 02:20:51 01463_resample_overflow: [ OK ] 0.48 sec.
2026-10-29 02:20:51 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 1.62 sec.
2026-10-29 02:20:51 01721_join_implicit_cast_long: [ OK ] 36.10 sec.
2026-10-29 02:20:51 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.40 sec.
2026-10-29 02:20:51 01458_count_digits: [ OK ] 0.42 sec.
2026-10-29 02:20:52 01458_named_tuple_millin: [ OK ] 0.35 sec.
2026-10-29 02:20:52 01458_is_decimal_overflow: [ OK ] 1.01 sec.
2026-10-29 02:20:53 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.53 sec.
2026-10-29 02:20:53 01453_normalize_query_alias_uuid: [ OK ] 0.39 sec.
2026-10-29 02:20:54 01456_low_cardinality_sorting_bugfix: [ OK ] 1.99 sec.
2026-10-29 02:20:55 01461_query_start_time_microseconds: [ OK ] 4.42 sec.
2026-10-29 02:20:55 01451_replicated_detach_drop_and_quorum_long: [ OK ] 1.27 sec.
2026-10-29 02:20:55 01451_replicated_detach_drop_part_long: [ OK ] 1.42 sec.
2026-10-29 02:20:55 01509_parallel_quorum_and_merge_long: [ OK ] 10.77 sec.
2026-10-29 02:20:56 01440_big_int_shift: [ OK ] 0.48 sec.
2026-10-29 02:20:56 01504_rocksdb: [ OK ] 8.73 sec.
2026-10-29 02:20:56 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.49 sec.
2026-10-29 02:20:56 01451_wrong_error_long_query: [ OK ] 1.65 sec.
2026-10-29 02:20:56 01436_storage_merge_with_join_push_down: [ OK ] 0.76 sec.
2026-10-29 02:20:57 01431_utf8_ubsan: [ OK ] 0.38 sec.
2026-10-29 02:20:57 01430_fix_any_rewrite_aliases: [ OK ] 0.34 sec.
2026-10-29 02:20:57 01440_big_int_exotic_casts: [ OK ] 1.48 sec.
2026-10-29 02:20:57 01425_default_value_of_type_name: [ OK ] 0.33 sec.
2026-10-29 02:20:57 01445_create_table_as_table_function: [ OK ] 2.26 sec.
2026-10-29 02:20:57 01428_hash_set_nan_key: [ OK ] 0.65 sec.
2026-10-29 02:20:57 01423_if_nullable_cond: [ OK ] 0.39 sec.
2026-10-29 02:20:57 01421_array_nullable_element_nullable_index: [ OK ] 0.38 sec.
2026-10-29 02:20:58 01419_merge_tree_settings_sanity_check: [ OK ] 0.83 sec.
2026-10-29 02:20:58 01416_clear_column_pk: [ OK ] 0.63 sec.
2026-10-29 02:20:58 01416_join_totals_header_bug: [ OK ] 0.77 sec.
2026-10-29 02:20:58 01414_freeze_does_not_prevent_alters: [ OK ] 1.01 sec.
2026-10-29 02:20:58 01413_alter_update_supertype: [ OK ] 0.48 sec.
2026-10-29 02:20:58 01413_truncate_without_table_keyword: [ OK ] 0.44 sec.
2026-10-29 02:20:59 01411_xor_itai_shirav: [ OK ] 0.36 sec.
2026-10-29 02:20:59 01430_modify_sample_by_zookeeper_long: [ OK ] 2.65 sec.
2026-10-29 02:20:59 01412_row_from_totals: [ OK ] 0.89 sec.
2026-10-29 02:20:59 01410_nullable_key_and_index_negate_cond: [ OK ] 0.91 sec.
2026-10-29 02:21:00 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.46 sec.
2026-10-29 02:21:00 01398_in_tuple_func: [ OK ] 0.50 sec.
2026-10-29 02:21:00 01389_filter_by_virtual_columns: [ OK ] 0.40 sec.
2026-10-29 02:21:00 01412_group_array_moving_shard: [ OK ] 1.76 sec.
2026-10-29 02:21:00 01381_for_each_with_states: [ OK ] 0.52 sec.
2026-10-29 02:21:01 01375_null_issue_3767: [ OK ] 0.39 sec.
2026-10-29 02:21:01 01359_geodistance_loop: [ OK ] 0.35 sec.
2026-10-29 02:21:01 01359_codeql: [ OK ] 0.35 sec.
2026-10-29 02:21:01 01358_constexpr_constraint: [ OK ] 0.46 sec.
2026-10-29 02:21:02 01380_nullable_state: [ OK ] 1.48 sec.
2026-10-29 02:21:02 01358_mutation_delete_null_rows: [ OK ] 0.64 sec.
2026-10-29 02:21:02 01406_carriage_return_in_tsv_csv: [ OK ] 3.12 sec.
2026-10-29 02:21:02 01356_initialize_aggregation: [ OK ] 0.71 sec.
2026-10-29 02:21:02 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.52 sec.
2026-10-29 02:21:03 01333_select_abc_asterisk: [ OK ] 0.43 sec.
2026-10-29 02:21:03 01328_bad_peephole_optimization: [ OK ] 0.66 sec.
2026-10-29 02:21:04 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 1.65 sec.
2026-10-29 02:21:04 01326_hostname_alias: [ OK ] 0.34 sec.
2026-10-29 02:21:04 01339_client_unrecognized_option: [ OK ] 2.06 sec.
2026-10-29 02:21:04 01326_build_id: [ OK ] 0.38 sec.
2026-10-29 02:21:05 01323_if_with_nulls: [ OK ] 0.68 sec.
2026-10-29 02:21:05 01322_monotonous_order_by_with_different_variables: [ OK ] 0.89 sec.
2026-10-29 02:21:05 01355_CSV_input_format_allow_errors: [ OK ] 3.46 sec.
2026-10-29 02:21:05 01505_pipeline_executor_UAF: [ OK ] 19.19 sec.
2026-10-29 02:21:05 01318_map_populate_series: [ OK ] 1.12 sec.
2026-10-29 02:21:05 01312_case_insensitive_regexp: [ OK ] 0.38 sec.
2026-10-29 02:21:06 01308_row_policy_and_trivial_count_query: [ OK ] 0.44 sec.
2026-10-29 02:21:06 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 20.46 sec.
2026-10-29 02:21:06 01303_polygons_equals: [ OK ] 0.36 sec.
2026-10-29 02:21:06 01305_polygons_union: [ OK ] 0.90 sec.
2026-10-29 02:21:06 01293_show_settings: [ OK ] 0.47 sec.
2026-10-29 02:21:06 01301_polygons_within: [ OK ] 0.67 sec.
2026-10-29 02:21:06 01293_pretty_max_value_width: [ OK ] 0.69 sec.
2026-10-29 02:21:06 01284_view_and_extremes_bug: [ OK ] 0.48 sec.
2026-10-29 02:21:07 01318_encrypt: [ OK ] 1.93 sec.
2026-10-29 02:21:07 01284_escape_sequences_php_mysql_style: [ OK ] 0.51 sec.
2026-10-29 02:21:07 01280_null_in: [ OK ] 0.46 sec.
2026-10-29 02:21:07 01281_sum_nullable: [ OK ] 0.59 sec.
2026-10-29 02:21:07 01280_unicode_whitespaces_lexer: [ OK ] 0.35 sec.
2026-10-29 02:21:08 01280_min_map_max_map: [ OK ] 1.46 sec.
2026-10-29 02:21:08 01278_variance_nonnegative: [ OK ] 1.11 sec.
2026-10-29 02:21:08 01283_strict_resize_bug: [ OK ] 2.10 sec.
2026-10-29 02:21:09 01289_min_execution_speed_not_too_early: [ OK ] 2.81 sec.
2026-10-29 02:21:09 01276_system_licenses: [ OK ] 0.71 sec.
2026-10-29 02:21:09 01276_alter_rename_column_materialized_expr: [ OK ] 1.46 sec.
2026-10-29 02:21:10 01283_max_threads_simple_query_optimization: [ OK ] 3.12 sec.
2026-10-29 02:21:10 01272_offset_without_limit: [ OK ] 0.41 sec.
2026-10-29 02:21:10 01271_show_privileges: [ OK ] 0.35 sec.
2026-10-29 02:21:11 01268_mv_scalars: [ OK ] 0.83 sec.
2026-10-29 02:21:12 01273_arrow_load: [ OK ] 2.88 sec.
2026-10-29 02:21:12 01264_nested_baloo_bear: [ OK ] 0.44 sec.
2026-10-29 02:21:12 01273_arrow_arrays_load: [ OK ] 3.68 sec.
2026-10-29 02:21:12 01273_arrow_nested_arrays_load: [ OK ] 3.51 sec.
2026-10-29 02:21:12 01259_datetime64_ubsan: [ OK ] 0.44 sec.
2026-10-29 02:21:12 01262_low_cardinality_remove: [ OK ] 0.64 sec.
2026-10-29 02:21:13 01273_arrow_nullable_arrays_load: [ OK ] 3.57 sec.
2026-10-29 02:21:13 01247_least_greatest_filimonov: [ OK ] 0.32 sec.
2026-10-29 02:21:13 01256_misspell_layout_name_podshumok: [ OK ] 0.36 sec.
2026-10-29 02:21:13 01259_combinator_distinct: [ OK ] 0.66 sec.
2026-10-29 02:21:14 01246_extractAllGroupsVertical: [ OK ] 0.95 sec.
2026-10-29 02:21:14 01232_untuple: [ OK ] 0.87 sec.
2026-10-29 02:21:15 01234_to_string_monotonic: [ OK ] 2.31 sec.
2026-10-29 02:21:15 01230_join_get_truncate: [ OK ] 0.95 sec.
2026-10-29 02:21:16 01220_scalar_optimization_in_alter: [ OK ] 0.39 sec.
2026-10-29 02:21:17 01214_test_storage_merge_aliases_with_where: [ OK ] 1.01 sec.
2026-10-29 02:21:17 01244_optimize_distributed_group_by_sharding_key: [ OK ] 4.73 sec.
2026-10-29 02:21:17 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.74 sec.
2026-10-29 02:21:17 01245_limit_infinite_sources: [ OK ] 4.86 sec.
2026-10-29 02:21:18 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.35 sec.
2026-10-29 02:21:18 01202_array_auc_special: [ OK ] 0.62 sec.
2026-10-29 02:21:19 01214_point_in_Mecca: [ OK ] 3.88 sec.
2026-10-29 02:21:19 01196_max_parser_depth: [ OK ] 1.95 sec.
2026-10-29 02:21:20 01144_multiword_data_types: [ OK ] 0.45 sec.
2026-10-29 02:21:21 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.72 sec.
2026-10-29 02:21:21 01246_buffer_flush: [ OK ] 8.74 sec.
2026-10-29 02:21:21 01137_sample_final: [ OK ] 0.62 sec.
2026-10-29 02:21:22 01123_parse_date_time_best_effort_even_more: [ OK ] 0.36 sec.
2026-10-29 02:21:22 01135_default_and_alter_zookeeper: [ OK ] 0.62 sec.
2026-10-29 02:21:22 01122_totals_rollup_having_block_header: [ OK ] 0.47 sec.
2026-10-29 02:21:22 01120_join_constants: [ OK ] 0.48 sec.
2026-10-29 02:21:23 01118_is_constant: [ OK ] 0.50 sec.
2026-10-29 02:21:24 01170_alter_partition_isolation: [ OK ] 5.92 sec.
2026-10-29 02:21:24 01115_prewhere_array_join: [ OK ] 2.20 sec.
2026-10-29 02:21:25 01165_lost_part_empty_partition: [ OK ] 6.53 sec.
2026-10-29 02:21:25 01115_join_with_dictionary: [ OK ] 2.25 sec.
2026-10-29 02:21:25 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:21:25 01104_distributed_numbers_test: [ OK ] 0.85 sec.
2026-10-29 02:21:25 01104_fixed_string_like: [ OK ] 0.96 sec.
2026-10-29 02:21:26 01107_join_right_table_totals: [ OK ] 1.66 sec.
2026-10-29 02:21:26 01102_distributed_local_in_bug: [ OK ] 0.52 sec.
2026-10-29 02:21:26 01097_pre_limit: [ OK ] 0.34 sec.
2026-10-29 02:21:26 01096_block_serialized_state: [ OK ] 0.32 sec.
2026-10-29 02:21:26 01096_zeros: [ OK ] 0.74 sec.
2026-10-29 02:21:26 01097_cyclic_defaults: [ OK ] 1.02 sec.
2026-10-29 02:21:27 01093_cyclic_defaults_filimonov: [ OK ] 0.48 sec.
2026-10-29 02:21:27 01089_alter_settings_old_format: [ OK ] 0.58 sec.
2026-10-29 02:21:27 01091_insert_with_default_json: [ OK ] 0.68 sec.
2026-10-29 02:21:27 01099_operators_date_and_timestamp: [ OK ] 1.81 sec.
2026-10-29 02:21:27 01088_array_slice_of_aggregate_functions: [ OK ] 0.39 sec.
2026-10-29 02:21:28 01085_extract_all_empty: [ OK ] 0.34 sec.
2026-10-29 02:21:28 01085_simdjson_uint64: [ OK ] 0.33 sec.
2026-10-29 02:21:28 01087_index_set_ubsan: [ OK ] 0.48 sec.
2026-10-29 02:21:28 01084_regexp_empty: [ OK ] 0.48 sec.
2026-10-29 02:21:28 01084_defaults_on_aliases: [ OK ] 0.71 sec.
2026-10-29 02:21:28 01082_bit_test_out_of_bound: [ OK ] 0.35 sec.
2026-10-29 02:21:28 01083_aggregation_memory_efficient_bug: [ OK ] 0.82 sec.
2026-10-29 02:21:28 01081_demangle: [ OK ] 0.34 sec.
2026-10-29 02:21:29 01079_new_range_reader_segfault: [ OK ] 0.57 sec.
2026-10-29 02:21:30 01079_alter_default_zookeeper_long: [ OK ] 1.31 sec.
2026-10-29 02:21:31 01079_bit_operations_using_bitset: [ OK ] 0.51 sec.
2026-10-29 02:21:31 01273_arrow_stream: [ OK ] 22.83 sec.
2026-10-29 02:21:33 01083_window_view_select: [ OK ] 4.86 sec.
2026-10-29 02:21:33 01074_h3_range_check: [ OK ] 0.58 sec.
2026-10-29 02:21:34 01080_window_view_inner_table_memory_hop: [ OK ] 5.20 sec.
2026-10-29 02:21:34 01156_pcg_deserialization: [ OK ] 14.33 sec.
2026-10-29 02:21:34 01073_bad_alter_partition: [ OK ] 0.73 sec.
2026-10-29 02:21:34 01073_crlf_end_of_line: [ OK ] 0.44 sec.
2026-10-29 02:21:34 01072_drop_temporary_table_with_same_name: [ OK ] 0.43 sec.
2026-10-29 02:21:34 01072_json_each_row_data_in_square_brackets: [ OK ] 0.37 sec.
2026-10-29 02:21:35 01070_alter_with_ttl: [ OK ] 0.51 sec.
2026-10-29 02:21:35 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 1.33 sec.
2026-10-29 02:21:35 01063_create_column_set: [ OK ] 0.40 sec.
2026-10-29 02:21:36 01069_materialized_view_alter_target_table: [ OK ] 1.05 sec.
2026-10-29 02:21:36 01076_json_each_row_array: [ OK ] 4.95 sec.
2026-10-29 02:21:40 01077_mutations_index_consistency: [ OK ] 8.44 sec.
2026-10-29 02:21:42 01058_window_view_event_hop_to_strict_asc: [ OK ] 5.83 sec.
2026-10-29 02:21:42 01060_window_view_event_tumble_to_asc: [ OK ] 6.55 sec.
2026-10-29 02:21:43 01055_prewhere_bugs: [ OK ] 0.57 sec.
2026-10-29 02:21:44 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 8.83 sec.
2026-10-29 02:21:44 01056_predicate_optimizer_bugs: [ OK ] 2.19 sec.
2026-10-29 02:21:44 01051_window_view_parser_hop: [ OK ] 0.62 sec.
2026-10-29 02:21:44 01079_order_by_pk: [ OK ] 16.05 sec.
2026-10-29 02:21:45 01050_engine_join_view_crash: [ OK ] 0.94 sec.
2026-10-29 02:21:45 01050_engine_join_crash: [ OK ] 0.98 sec.
2026-10-29 02:21:46 01058_zlib_ng_level1_bug: [ OK ] 6.71 sec.
2026-10-29 02:21:46 01460_line_as_string_format: [ OK ] 55.68 sec.
2026-10-29 02:21:46 01049_join_low_card_crash: [ OK ] 0.91 sec.
2026-10-29 02:21:47 01049_zookeeper_synchronous_mutations_long: [ OK ] 1.64 sec.
2026-10-29 02:21:47 01054_random_printable_ascii_ubsan: [ OK ] 4.21 sec.
2026-10-29 02:21:47 01047_no_alias_columns_with_table_aliases: [ OK ] 0.73 sec.
2026-10-29 02:21:47 01045_array_zip: [ OK ] 0.78 sec.
2026-10-29 02:21:47 01044_h3_edge_angle: [ OK ] 0.36 sec.
2026-10-29 02:21:47 01043_h3_edge_length_m: [ OK ] 0.37 sec.
2026-10-29 02:21:48 01045_bloom_filter_null_array: [ OK ] 0.58 sec.
2026-10-29 02:21:48 01040_h3_get_resolution: [ OK ] 0.41 sec.
2026-10-29 02:21:48 01036_union_different_columns: [ OK ] 0.52 sec.
2026-10-29 02:21:48 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.91 sec.
2026-10-29 02:21:49 01037_zookeeper_check_table_empty_pk: [ OK ] 1.03 sec.
2026-10-29 02:21:49 01035_prewhere_with_alias: [ OK ] 0.49 sec.
2026-10-29 02:21:49 01034_unknown_qualified_column_in_join: [ OK ] 0.60 sec.
2026-10-29 02:21:49 01039_row_policy_dcl: [ OK ] 1.79 sec.
2026-10-29 02:21:49 01032_cityHash64_for_UUID: [ OK ] 0.83 sec.
2026-10-29 02:21:51 01021_only_tuple_columns: [ OK ] 1.15 sec.
2026-10-29 02:21:51 01034_JSONCompactEachRow: [ OK ] 2.47 sec.
2026-10-29 02:21:51 01020_having_without_group_by: [ OK ] 0.43 sec.
2026-10-29 02:21:52 01019_materialized_view_select_extra_columns: [ OK ] 0.57 sec.
2026-10-29 02:21:52 01019_array_fill: [ OK ] 0.46 sec.
2026-10-29 02:21:52 01030_limit_by_with_ties_error: [ OK ] 3.18 sec.
2026-10-29 02:21:53 01031_mutations_interpreter_and_context: [ OK ] 4.12 sec.
2026-10-29 02:21:53 01017_uniqCombined_memory_usage: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:21:53 01018_ddl_dictionaries_special: [ OK ] 1.69 sec.
2026-10-29 02:21:53 01017_bithamming_distance: [ OK ] 1.02 sec.
2026-10-29 02:21:54 01016_macros: [ OK ] 0.39 sec.
2026-10-29 02:21:54 01018_Distributed__shard_num: [ OK ] 1.95 sec.
2026-10-29 02:21:54 01013_totals_without_aggregation: [ OK ] 0.71 sec.
2026-10-29 02:21:54 01012_select_limit_x_0: [ OK ] 0.37 sec.
2026-10-29 02:21:54 01014_count_of_merges_metrics: [ OK ] 1.02 sec.
2026-10-29 02:21:55 01011_group_uniq_array_memsan: [ OK ] 0.49 sec.
2026-10-29 02:21:55 01011_test_create_as_skip_indices: [ OK ] 0.96 sec.
2026-10-29 02:21:56 01010_partial_merge_join_const_and_lc: [ OK ] 1.19 sec.
2026-10-29 02:21:56 01010_pm_join_all_join_bug: [ OK ] 0.84 sec.
2026-10-29 02:21:56 01009_global_array_join_names: [ OK ] 0.82 sec.
2026-10-29 02:21:57 01009_insert_select_data_loss: [ OK ] 0.52 sec.
2026-10-29 02:21:58 01014_format_custom_separated: [ OK ] 4.97 sec.
2026-10-29 02:21:59 00999_nullable_nested_types_4877: [ OK ] 2.00 sec.
2026-10-29 02:21:59 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.81 sec.
2026-10-29 02:22:01 00996_neighbor: [ OK ] 1.68 sec.
2026-10-29 02:22:07 01035_avg: [ OK ] 19.45 sec.
2026-10-29 02:22:09 01010_partial_merge_join: [ OK ] 13.57 sec.
2026-10-29 02:22:09 00981_no_virtual_columns: [ OK ] 1.65 sec.
2026-10-29 02:22:10 00978_ml_math: [ OK ] 0.45 sec.
2026-10-29 02:22:12 00975_recursive_materialized_view: [ OK ] 1.95 sec.
2026-10-29 02:22:12 01004_rename_deadlock: [ OK ] 15.13 sec.
2026-10-29 02:22:12 00986_materialized_view_stack_overflow: [ OK ] 11.43 sec.
2026-10-29 02:22:12 01049_join_low_card_bug_long: [ OK ] 27.94 sec.
2026-10-29 02:22:13 00974_low_cardinality_cast: [ OK ] 0.68 sec.
2026-10-29 02:22:13 00975_sample_prewhere_distributed: [ OK ] 1.22 sec.
2026-10-29 02:22:13 00974_full_outer_join: [ OK ] 0.66 sec.
2026-10-29 02:22:15 00974_fix_join_on: [ OK ] 2.44 sec.
2026-10-29 02:22:16 00969_roundDuration: [ OK ] 0.85 sec.
2026-10-29 02:22:17 00980_zookeeper_merge_tree_alter_settings: [ OK ] 7.87 sec.
2026-10-29 02:22:17 00968_roundAge: [ OK ] 0.45 sec.
2026-10-29 02:22:17 00969_columns_clause: [ OK ] 1.13 sec.
2026-10-29 02:22:18 00967_ubsan_bit_test: [ OK ] 0.35 sec.
2026-10-29 02:22:18 00975_json_hang: [ OK ] 6.44 sec.
2026-10-29 02:22:19 00967_insert_into_distributed_different_types: [ OK ] 0.99 sec.
2026-10-29 02:22:21 00974_primary_key_for_lowCardinality: [ OK ] 7.95 sec.
2026-10-29 02:22:22 00953_indices_alter_exceptions: [ OK ] 3.48 sec.
2026-10-29 02:22:23 00972_geohashesInBox: [ OK ] 9.22 sec.
2026-10-29 02:22:24 00952_part_frozen_info: [ OK ] 1.18 sec.
2026-10-29 02:22:24 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.39 sec.
2026-10-29 02:22:25 00953_constraints_operations: [ OK ] 6.31 sec.
2026-10-29 02:22:27 00950_test_gorilla_codec: [ OK ] 2.27 sec.
2026-10-29 02:22:28 00944_ml_test: [ OK ] 1.38 sec.
2026-10-29 02:22:29 00942_mv_rename_table: [ OK ] 0.68 sec.
2026-10-29 02:22:30 00952_basic_constraints: [ OK ] 7.80 sec.
2026-10-29 02:22:30 00939_limit_by_offset: [ OK ] 0.65 sec.
2026-10-29 02:22:31 00940_max_parts_in_total: [ OK ] 1.63 sec.
2026-10-29 02:22:31 00938_dataset_test: [ OK ] 1.20 sec.
2026-10-29 02:22:32 01395_limit_more_cases: [ OK ] 92.46 sec.
2026-10-29 02:22:32 00991_system_parts_race_condition_long: [ OK ] 32.74 sec.
2026-10-29 02:22:32 00936_function_result_with_operator_in: [ OK ] 0.67 sec.
2026-10-29 02:22:32 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.55 sec.
2026-10-29 02:22:33 00964_bloom_index_string_functions: [ OK ] 14.99 sec.
2026-10-29 02:22:33 00927_asof_join_noninclusive: [ OK ] 0.68 sec.
2026-10-29 02:22:35 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 2.16 sec.
2026-10-29 02:22:35 00914_replicate: [ OK ] 0.43 sec.
2026-10-29 02:22:35 00952_input_function: [ OK ] 14.37 sec.
2026-10-29 02:22:36 00910_decimal_group_array_crash_3783: [ OK ] 1.04 sec.
2026-10-29 02:22:37 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 4.51 sec.
2026-10-29 02:22:39 00937_test_use_header_csv: [ OK ] 8.32 sec.
2026-10-29 02:22:40 00904_array_with_constant_2: [ OK ] 1.12 sec.
2026-10-29 02:22:41 00906_low_cardinality_rollup: [ OK ] 3.29 sec.
2026-10-29 02:22:43 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 10.07 sec.
2026-10-29 02:22:43 00926_adaptive_index_granularity_merge_tree: [ OK ] 10.45 sec.
2026-10-29 02:22:43 00913_many_threads: [ OK ] 8.34 sec.
2026-10-29 02:22:44 00876_wrong_arraj_join_column: [ OK ] 0.97 sec.
2026-10-29 02:22:44 00900_null_array_orc_load: [ OK ] 3.39 sec.
2026-10-29 02:22:44 00860_unknown_identifier_bug: [ OK ] 0.83 sec.
2026-10-29 02:22:45 00945_bloom_filter_index: [ OK ] 20.18 sec.
2026-10-29 02:22:45 00875_join_right_nulls_ors: [ OK ] 2.49 sec.
2026-10-29 02:22:46 00853_join_with_nulls_crash: [ OK ] 1.53 sec.
2026-10-29 02:22:46 00844_join_lightee2: [ OK ] 0.57 sec.
2026-10-29 02:22:46 00857_global_joinsavel_table_alias: [ FAIL ] 2.68 sec. - result differs with reference:
2026-10-29 02:22:46 --- /usr/share/clickhouse-test/queries/0_stateless/00857_global_joinsavel_table_alias.reference 2026-10-29 02:10:37.939166823 +0300
2026-10-29 02:22:46 +++ /tmp/clickhouse-test/0_stateless/00857_global_joinsavel_table_alias.stdout 2026-10-29 02:22:46.849109054 +0300
2026-10-29 02:22:46 @@ -6,7 +6,7 @@
2026-10-29 02:22:46 Two Hundred
2026-10-29 02:22:46 One Hundred
2026-10-29 02:22:46 Two Hundred
2026-10-29 02:22:46 -One Hundred
2026-10-29 02:22:46 -Two Hundred
2026-10-29 02:22:46 +
2026-10-29 02:22:46 +
2026-10-29 02:22:46 One Hundred
2026-10-29 02:22:46 Two Hundred
2026-10-29 02:22:46
2026-10-29 02:22:46
2026-10-29 02:22:46 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 7313257 --max_read_buffer_size 1015139 --prefer_localhost_replica 0 --max_block_size 45038 --max_threads 9 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 49 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 22479335 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 22 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 2493562672 --min_compress_block_size 90599 --max_compress_block_size 1042617 --merge_tree_compact_parts_min_granules_to_multibuffer_read 29 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 4636018 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone Africa/Khartoum --prefer_warmed_unmerged_parts_seconds 2 --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.11
2026-10-29 02:22:46
2026-10-29 02:22:46 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 7948238251 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 8413957430 --index_granularity_bytes 2563905 --merge_max_block_size 13915 --index_granularity 45316 --min_bytes_for_wide_part 115778564 --marks_compress_block_size 11695 --primary_key_compress_block_size 61064 --replace_long_file_name_to_hash 1 --max_file_name_length 91 --min_bytes_for_full_part_storage 273951432 --compact_parts_max_bytes_to_buffer 201403357 --compact_parts_max_granules_to_buffer 30 --compact_parts_merge_max_bytes_to_prefetch_part 3628516 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 480
2026-10-29 02:22:46
2026-10-29 02:22:46 Database: test_nxe6k6ss
2026-10-29 02:22:46 00842_array_with_constant_overflow: [ OK ] 0.52 sec.
2026-10-29 02:22:47 00841_temporary_table_database: [ OK ] 0.48 sec.
2026-10-29 02:22:47 00839_bitmask_negative: [ OK ] 0.46 sec.
2026-10-29 02:22:47 00847_multiple_join_same_column: [ OK ] 1.82 sec.
2026-10-29 02:22:47 00835_if_generic_case: [ OK ] 0.67 sec.
2026-10-29 02:22:47 00834_not_between: [ OK ] 0.42 sec.
2026-10-29 02:22:47 00849_multiple_comma_join_2: [ OK ] 3.02 sec.
2026-10-29 02:22:48 00831_quantile_weighted_parameter_check: [ OK ] 0.46 sec.
2026-10-29 02:22:48 00900_orc_arrow_parquet_tuples: [ OK ] 7.85 sec.
2026-10-29 02:22:49 00836_indices_alter_replicated_zookeeper_long: [ OK ] 2.08 sec.
2026-10-29 02:22:49 00834_limit_with_constant_expressions: [ OK ] 1.55 sec.
2026-10-29 02:22:49 00829_bitmap64_function: [ OK ] 1.92 sec.
2026-10-29 02:22:50 00821_distributed_storage_with_join_on: [ OK ] 1.22 sec.
2026-10-29 02:22:50 00826_cross_to_inner_join: [ OK ] 2.31 sec.
2026-10-29 02:22:50 00814_parsing_ub: [ OK ] 0.49 sec.
2026-10-29 02:22:51 00820_multiple_joins_subquery_requires_alias: [ OK ] 1.45 sec.
2026-10-29 02:22:51 00818_alias_bug_4110: [ OK ] 0.94 sec.
2026-10-29 02:22:51 00809_add_days_segfault: [ OK ] 0.97 sec.
2026-10-29 02:22:52 00825_protobuf_format_skipped_column_in_nested: [ OK ] 3.99 sec.
2026-10-29 02:22:52 00803_odbc_driver_2_format: [ OK ] 0.49 sec.
2026-10-29 02:22:52 00825_protobuf_format_splitted_nested: [ OK ] 3.96 sec.
2026-10-29 02:22:52 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.57 sec.
2026-10-29 02:22:53 00808_not_optimize_predicate: [ OK ] 1.72 sec.
2026-10-29 02:22:53 00800_function_java_hash: [ OK ] 0.55 sec.
2026-10-29 02:22:53 00779_all_right_join_max_block_size: [ OK ] 0.37 sec.
2026-10-29 02:22:53 00757_enum_defaults_const_analyzer: [ OK ] 0.46 sec.
2026-10-29 02:22:54 00758_array_reverse: [ OK ] 0.87 sec.
2026-10-29 02:22:54 00757_enum_defaults_const: [ OK ] 0.46 sec.
2026-10-29 02:22:54 00804_test_custom_compression_codes_log_storages: [ OK ] 3.25 sec.
2026-10-29 02:22:54 00760_insert_json_with_defaults: [ OK ] 1.47 sec.
2026-10-29 02:22:55 00753_distributed_system_columns_and_system_tables: [ OK ] 0.75 sec.
2026-10-29 02:22:55 00753_alter_destination_for_storage_buffer: [ OK ] 1.42 sec.
2026-10-29 02:22:56 00752_low_cardinality_permute: [ OK ] 0.76 sec.
2026-10-29 02:22:56 00752_low_cardinality_array_result: [ OK ] 0.32 sec.
2026-10-29 02:22:57 00752_low_cardinality_lambda_argument: [ OK ] 1.16 sec.
2026-10-29 02:22:57 00754_alter_modify_column_partitions: [ OK ] 3.28 sec.
2026-10-29 02:22:57 00823_sequence_match_dfa: [ OK ] 8.68 sec.
2026-10-29 02:22:57 00800_low_cardinality_merge_join: [ OK ] 5.43 sec.
2026-10-29 02:22:57 00746_hashing_tuples: [ OK ] 0.61 sec.
2026-10-29 02:22:58 01062_pm_all_join_with_block_continuation: [ OK ] 82.08 sec.
2026-10-29 02:22:58 00742_require_join_strictness: [ OK ] 0.40 sec.
2026-10-29 02:22:58 00743_limit_by_not_found_column: [ OK ] 0.57 sec.
2026-10-29 02:22:58 00738_nested_merge_multidimensional_array: [ OK ] 0.92 sec.
2026-10-29 02:22:58 00740_database_in_nested_view: [ OK ] 0.95 sec.
2026-10-29 02:22:59 00753_alter_attach: [ OK ] 4.90 sec.
2026-10-29 02:22:59 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 1.36 sec.
2026-10-29 02:22:59 00730_unicode_terminal_format: [ OK ] 0.78 sec.
2026-10-29 02:22:59 00726_length_aliases: [ OK ] 0.36 sec.
2026-10-29 02:22:59 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 1.71 sec.
2026-10-29 02:23:00 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 1.24 sec.
2026-10-29 02:23:01 00725_memory_tracking: [ FAIL ] 1.50 sec. - return code: 128
2026-10-29 02:23:01 [8845d794fca2] 2026.10.29 01:23:01.016982 [ 10794 ] {197bba4a-df5c-4994-b9d3-2d28c13c28e2} executeQuery: Code: 128. DB::Exception: Array of size 100000000 is too large to be manipulated as single field, maximum size 1000000: In scope SELECT length(range(100000000)). (TOO_LARGE_ARRAY_SIZE) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:50372) (comment: 00725_memory_tracking.sql) (in query: SELECT length(range(100000000));), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:23:01
2026-10-29 02:23:01 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003a555553
2026-10-29 02:23:01 1. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001cb490b0
2026-10-29 02:23:01 2. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, unsigned long&, unsigned long const&) @ 0x000000000cfe229d
2026-10-29 02:23:01 3. ./build_docker/./src/Columns/ColumnArray.cpp:140: DB::ColumnArray::get(unsigned long, DB::Field&) const @ 0x000000002f628c64
2026-10-29 02:23:01 4. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:0: DB::(anonymous namespace)::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x000000002dc11cf7
2026-10-29 02:23:01 5. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:0: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x000000002dbcb3e5
2026-10-29 02:23:01 6. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:6643: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x000000002dbc90a7
2026-10-29 02:23:01 7. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:5548: DB::(anonymous namespace)::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x000000002dc05403
2026-10-29 02:23:01 8. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:0: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x000000002dbcb3e5
2026-10-29 02:23:01 9. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:6643: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x000000002dbc90a7
2026-10-29 02:23:01 10. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:6902: DB::(anonymous namespace)::QueryAnalyzer::resolveProjectionExpressionNodeList(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x000000002dbe3b1a
2026-10-29 02:23:01 11. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:0: DB::(anonymous namespace)::QueryAnalyzer::resolveQuery(std::shared_ptr const&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x000000002dbb2884
2026-10-29 02:23:01 12. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:0: DB::QueryAnalysisPass::run(std::shared_ptr&, std::shared_ptr) @ 0x000000002dbabd17
2026-10-29 02:23:01 13. ./build_docker/./src/Analyzer/QueryTreePassManager.cpp:0: DB::QueryTreePassManager::run(std::shared_ptr) @ 0x000000002dba2dce
2026-10-29 02:23:01 14. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:0: DB::(anonymous namespace)::buildQueryTreeAndRunPasses(std::shared_ptr const&, DB::SelectQueryOptions const&, std::shared_ptr const&, std::shared_ptr const&) @ 0x000000002e5ea2f6
2026-10-29 02:23:01 15. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:160: DB::InterpreterSelectQueryAnalyzer::InterpreterSelectQueryAnalyzer(std::shared_ptr const&, std::shared_ptr const&, DB::SelectQueryOptions const&, std::vector> const&) @ 0x000000002e5e2e14
2026-10-29 02:23:01 16. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:0: std::__unique_if::__unique_single std::make_unique[abi:v15000]&, std::shared_ptr const&, DB::SelectQueryOptions const&>(std::shared_ptr&, std::shared_ptr const&, DB::SelectQueryOptions const&) @ 0x000000002e5edf41
2026-10-29 02:23:01 17. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000002e49ee7d
2026-10-29 02:23:01 18. ./build_docker/./src/Interpreters/executeQuery.cpp:0: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x000000002f226a0a
2026-10-29 02:23:01 19. ./build_docker/./src/Interpreters/executeQuery.cpp:1376: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x000000002f21da8a
2026-10-29 02:23:01 20. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x000000003272defd
2026-10-29 02:23:01 21. ./build_docker/./src/Server/TCPHandler.cpp:2341: DB::TCPHandler::run() @ 0x0000000032772951
2026-10-29 02:23:01 22. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x000000003a25d88f
2026-10-29 02:23:01 23. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x000000003a25e537
2026-10-29 02:23:01 24. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:0: Poco::PooledThread::run() @ 0x000000003a66b51c
2026-10-29 02:23:01 25. ./base/poco/Foundation/include/Poco/SharedPtr.h:231: Poco::ThreadImpl::runnableEntry(void*) @ 0x000000003a664508
2026-10-29 02:23:01 26. asan_thread_start(void*) @ 0x000000000a7b9f1b
2026-10-29 02:23:01 27. ? @ 0x00007f8b20295ac3
2026-10-29 02:23:01 28. ? @ 0x00007f8b20327850
2026-10-29 02:23:01
2026-10-29 02:23:01 Received exception from server (version 24.3.18):
2026-10-29 02:23:01 Code: 128. DB::Exception: Received from localhost:9000. DB::Exception: Array of size 100000000 is too large to be manipulated as single field, maximum size 1000000: In scope SELECT length(range(100000000)). (TOO_LARGE_ARRAY_SIZE)
2026-10-29 02:23:01 (query: SELECT length(range(100000000));)
2026-10-29 02:23:01 , result:
2026-10-29 02:23:01
2026-10-29 02:23:01 0
2026-10-29 02:23:01
2026-10-29 02:23:01 stdout:
2026-10-29 02:23:01 0
2026-10-29 02:23:01
2026-10-29 02:23:01
2026-10-29 02:23:01 Settings used in the test: --max_insert_threads 0 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 1 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 11156092 --max_read_buffer_size 758347 --prefer_localhost_replica 0 --max_block_size 22634 --max_threads 21 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 79 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 24172747 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 8619526937 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 20 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 6636535216 --max_bytes_before_remerge_sort 1417917848 --min_compress_block_size 2244245 --max_compress_block_size 2510210 --merge_tree_compact_parts_min_granules_to_multibuffer_read 21 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 9992175 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone Africa/Juba --prefer_warmed_unmerged_parts_seconds 1 --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.52
2026-10-29 02:23:01
2026-10-29 02:23:01 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0076786946256816035 --prefer_fetch_merged_part_size_threshold 1299729232 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 10119284 --merge_max_block_size 1568 --index_granularity 44459 --min_bytes_for_wide_part 6463671 --marks_compress_block_size 43826 --primary_key_compress_block_size 82185 --replace_long_file_name_to_hash 0 --max_file_name_length 112 --min_bytes_for_full_part_storage 58838844 --compact_parts_max_bytes_to_buffer 145500442 --compact_parts_max_granules_to_buffer 251 --compact_parts_merge_max_bytes_to_prefetch_part 9477623 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 86 --old_parts_lifetime 210
2026-10-29 02:23:01
2026-10-29 02:23:01 Database: test_g7dw7i0r
2026-10-29 02:23:01 00712_nan_comparison: [ OK ] 1.06 sec.
2026-10-29 02:23:01 00723_remerge_sort: [ OK ] 1.55 sec.
2026-10-29 02:23:01 00712_prewhere_with_final: [ OK ] 0.76 sec.
2026-10-29 02:23:01 00908_bloom_filter_index: [ OK ] 25.06 sec.
2026-10-29 02:23:02 00712_prewhere_with_alias: [ OK ] 0.97 sec.
2026-10-29 02:23:02 00738_lock_for_inner_table: [ OK ] 4.79 sec.
2026-10-29 02:23:02 00751_low_cardinality_nullable_group_by: [ OK ] 6.52 sec.
2026-10-29 02:23:02 00719_insert_block_without_column: [ OK ] 3.05 sec.
2026-10-29 02:23:03 00700_decimal_defaults: [ OK ] 0.55 sec.
2026-10-29 02:23:03 00700_to_decimal_or_something: [ OK ] 1.73 sec.
2026-10-29 02:23:03 00700_decimal_null: [ OK ] 1.52 sec.
2026-10-29 02:23:03 00717_merge_and_distributed: [ OK ] 3.91 sec.
2026-10-29 02:23:04 00700_decimal_in_keys: [ OK ] 1.19 sec.
2026-10-29 02:23:04 00694_max_block_size_zero: [ OK ] 0.58 sec.
2026-10-29 02:23:04 00688_low_cardinality_alter_add_column: [ OK ] 0.56 sec.
2026-10-29 02:23:04 00700_decimal_math: [ OK ] 1.72 sec.
2026-10-29 02:23:04 00688_low_cardinality_defaults: [ OK ] 0.51 sec.
2026-10-29 02:23:05 00700_decimal_aggregates: [ OK ] 3.85 sec.
2026-10-29 02:23:05 00685_output_format_json_escape_forward_slashes: [ OK ] 0.39 sec.
2026-10-29 02:23:05 00687_insert_into_mv: [ OK ] 0.80 sec.
2026-10-29 02:23:05 00668_compare_arrays_silviucpp: [ OK ] 0.44 sec.
2026-10-29 02:23:05 00679_uuid_in_key: [ OK ] 0.68 sec.
2026-10-29 02:23:05 00700_to_decimal_or_something_1: [ OK ] 3.97 sec.
2026-10-29 02:23:06 00688_low_cardinality_syntax: [ OK ] 1.63 sec.
2026-10-29 02:23:06 00678_shard_funnel_window: [ OK ] 0.83 sec.
2026-10-29 02:23:06 00667_compare_arrays_of_different_types: [ OK ] 0.44 sec.
2026-10-29 02:23:06 00686_client_exit_code: [ OK ] 1.70 sec.
2026-10-29 02:23:06 00662_has_nullable: [ OK ] 0.62 sec.
2026-10-29 02:23:06 00661_array_has_silviucpp: [ OK ] 0.41 sec.
2026-10-29 02:23:06 00700_decimal_arithm: [ OK ] 3.12 sec.
2026-10-29 02:23:06 00662_array_has_nullable: [ OK ] 1.06 sec.
2026-10-29 02:23:07 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.93 sec.
2026-10-29 02:23:07 00666_uniq_complex_types: [ OK ] 1.30 sec.
2026-10-29 02:23:07 00700_decimal_casts: [ OK ] 3.66 sec.
2026-10-29 02:23:07 00649_quantile_tdigest_negative: [ OK ] 0.34 sec.
2026-10-29 02:23:07 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.68 sec.
2026-10-29 02:23:07 00647_select_numbers_with_offset: [ OK ] 0.45 sec.
2026-10-29 02:23:07 00647_histogram: [ OK ] 0.74 sec.
2026-10-29 02:23:07 00627_recursive_alias: [ OK ] 0.36 sec.
2026-10-29 02:23:07 00628_in_lambda_on_merge_table_bug: [ OK ] 0.66 sec.
2026-10-29 02:23:07 00647_multiply_aggregation_state: [ OK ] 0.89 sec.
2026-10-29 02:23:08 00619_union_highlite: [ OK ] 0.65 sec.
2026-10-29 02:23:08 00637_sessions_in_http_interface_and_settings: [ OK ] 1.46 sec.
2026-10-29 02:23:09 00623_replicated_truncate_table_zookeeper_long: [ OK ] 1.03 sec.
2026-10-29 02:23:09 00626_replace_partition_from_table: [ OK ] 1.47 sec.
2026-10-29 02:23:09 00623_truncate_table: [ OK ] 1.45 sec.
2026-10-29 02:23:09 00619_extract: [ OK ] 0.51 sec.
2026-10-29 02:23:09 00623_in_partition_key: [ OK ] 1.63 sec.
2026-10-29 02:23:09 00612_union_query_with_subquery: [ OK ] 0.54 sec.
2026-10-29 02:23:09 00612_http_max_query_size_for_distributed: [ OK ] 0.76 sec.
2026-10-29 02:23:09 00618_nullable_in: [ OK ] 1.12 sec.
2026-10-29 02:23:09 00609_distributed_with_case_when_then: [ OK ] 0.67 sec.
2026-10-29 02:23:09 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.68 sec.
2026-10-29 02:23:10 00652_replicated_mutations_default_database_zookeeper: [ OK ] 3.36 sec.
2026-10-29 02:23:10 00604_show_create_database: [ OK ] 0.29 sec.
2026-10-29 02:23:10 00606_quantiles_and_nans: [ OK ] 0.36 sec.
2026-10-29 02:23:10 00607_index_in_in: [ OK ] 0.53 sec.
2026-10-29 02:23:10 00590_limit_by_column_removal: [ OK ] 0.63 sec.
2026-10-29 02:23:10 00560_float_leading_plus_in_exponent: [ OK ] 0.50 sec.
2026-10-29 02:23:10 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.58 sec.
2026-10-29 02:23:10 00568_empty_function_with_fixed_string: [ OK ] 0.72 sec.
2026-10-29 02:23:11 00609_prewhere_and_default: [ OK ] 1.48 sec.
2026-10-29 02:23:11 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.49 sec.
2026-10-29 02:23:11 00555_right_join_excessive_rows: [ OK ] 0.40 sec.
2026-10-29 02:23:11 00556_array_intersect: [ OK ] 0.50 sec.
2026-10-29 02:23:11 00552_logical_functions_uint8_as_bool: [ OK ] 0.52 sec.
2026-10-29 02:23:11 00594_alias_in_distributed: [ OK ] 1.66 sec.
2026-10-29 02:23:11 00551_parse_or_null: [ OK ] 0.47 sec.
2026-10-29 02:23:11 00552_or_nullable: [ OK ] 0.82 sec.
2026-10-29 02:23:11 00545_weird_aggregate_functions: [ OK ] 0.44 sec.
2026-10-29 02:23:12 00534_exp10: [ OK ] 0.38 sec.
2026-10-29 02:23:12 00538_datediff_plural_units: [ OK ] 0.47 sec.
2026-10-29 02:23:12 00527_totals_having_nullable: [ OK ] 0.50 sec.
2026-10-29 02:23:12 00538_datediff: [ OK ] 1.15 sec.
2026-10-29 02:23:13 00585_union_all_subquery_aggregation_column_removal: [ OK ] 3.20 sec.
2026-10-29 02:23:13 00550_join_insert_select: [ OK ] 2.48 sec.
2026-10-29 02:23:14 00521_multidimensional: [ OK ] 1.24 sec.
2026-10-29 02:23:14 00520_http_nullable: [ OK ] 1.46 sec.
2026-10-29 02:23:14 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.75 sec.
2026-10-29 02:23:15 00514_interval_operators: [ OK ] 1.09 sec.
2026-10-29 02:23:16 00508_materialized_view_to: [ OK ] 1.09 sec.
2026-10-29 02:23:16 00522_multidimensional: [ OK ] 3.35 sec.
2026-10-29 02:23:16 00515_enhanced_time_zones: [ OK ] 2.53 sec.
2026-10-29 02:23:16 00503_cast_const_nullable: [ OK ] 0.36 sec.
2026-10-29 02:23:16 00502_string_concat_with_array: [ OK ] 0.39 sec.
2026-10-29 02:23:17 00499_json_enum_insert: [ OK ] 0.58 sec.
2026-10-29 02:23:17 00500_point_in_polygon: [ OK ] 1.25 sec.
2026-10-29 02:23:18 00492_drop_temporary_table: [ OK ] 0.42 sec.
2026-10-29 02:23:18 00507_array_no_params: [ OK ] 2.31 sec.
2026-10-29 02:23:18 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.41 sec.
2026-10-29 02:23:19 00482_subqueries_and_aliases: [ OK ] 0.47 sec.
2026-10-29 02:23:19 00477_parsing_data_types: [ OK ] 0.38 sec.
2026-10-29 02:23:20 00476_pretty_formats_and_widths: [ OK ] 0.39 sec.
2026-10-29 02:23:20 00471_sql_style_quoting: [ OK ] 0.38 sec.
2026-10-29 02:23:21 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.48 sec.
2026-10-29 02:23:21 00506_union_distributed: [ OK ] 5.38 sec.
2026-10-29 02:23:21 00465_nullable_default: [ OK ] 0.53 sec.
2026-10-29 02:23:21 00462_json_true_false_literals: [ OK ] 0.38 sec.
2026-10-29 02:23:22 00484_preferred_max_column_in_block_size_bytes: [ OK ] 4.33 sec.
2026-10-29 02:23:22 00460_vertical_and_totals_extremes: [ OK ] 0.77 sec.
2026-10-29 02:23:22 00459_group_array_insert_at: [ OK ] 0.86 sec.
2026-10-29 02:23:23 00450_higher_order_and_nullable: [ OK ] 0.37 sec.
2026-10-29 02:23:23 00453_cast_enum: [ OK ] 0.71 sec.
2026-10-29 02:23:23 00449_filter_array_nullable_tuple: [ OK ] 0.65 sec.
2026-10-29 02:23:23 00447_foreach_modifier: [ OK ] 0.73 sec.
2026-10-29 02:23:24 00445_join_nullable_keys: [ OK ] 0.47 sec.
2026-10-29 02:23:24 00497_whitespaces_in_insert: [ OK ] 6.48 sec.
2026-10-29 02:23:24 00434_tonullable: [ OK ] 0.38 sec.
2026-10-29 02:23:24 00653_verification_monotonic_data_load: [ OK ] 18.30 sec.
2026-10-29 02:23:25 00426_nulls_sorting: [ OK ] 0.82 sec.
2026-10-29 02:23:25 00437_nulls_first_last: [ OK ] 1.62 sec.
2026-10-29 02:23:27 00431_if_nulls: [ OK ] 2.58 sec.
2026-10-29 02:23:27 00411_merge_tree_where_const_in_set: [ OK ] 0.82 sec.
2026-10-29 02:23:28 00402_nan_and_extremes: [ OK ] 0.56 sec.
2026-10-29 02:23:29 00534_functions_bad_arguments2: [ OK ] 17.43 sec.
2026-10-29 02:23:29 00396_uuid: [ OK ] 0.55 sec.
2026-10-29 02:23:29 00417_kill_query: [ OK ] 4.38 sec.
2026-10-29 02:23:30 00389_concat_operator: [ OK ] 0.47 sec.
2026-10-29 02:23:31 00400_client_external_options: [ OK ] 3.00 sec.
2026-10-29 02:23:31 00392_enum_nested_alter: [ OK ] 1.63 sec.
2026-10-29 02:23:32 00387_use_client_time_zone: [ OK ] 1.64 sec.
2026-10-29 02:23:32 00370_duplicate_columns_in_subqueries: [ OK ] 0.64 sec.
2026-10-29 02:23:32 00379_system_processes_port: [ OK ] 1.32 sec.
2026-10-29 02:23:33 00369_int_div_of_float: [ OK ] 0.40 sec.
2026-10-29 02:23:33 00380_client_break_at_exception_in_batch_mode: [ OK ] 1.76 sec.
2026-10-29 02:23:33 00362_great_circle_distance: [ OK ] 0.50 sec.
2026-10-29 02:23:34 00368_format_option_collision: [ OK ] 1.67 sec.
2026-10-29 02:23:34 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.93 sec.
2026-10-29 02:23:35 00358_from_string_complex_types: [ OK ] 0.37 sec.
2026-10-29 02:23:35 00357_to_string_complex_types: [ OK ] 1.02 sec.
2026-10-29 02:23:36 00443_optimize_final_vertical_merge: [ OK ] 12.67 sec.
2026-10-29 02:23:36 00353_join_by_tuple: [ OK ] 0.61 sec.
2026-10-29 02:23:37 00351_select_distinct_arrays_tuples: [ OK ] 0.44 sec.
2026-10-29 02:23:37 00348_tuples: [ OK ] 0.64 sec.
2026-10-29 02:23:37 00365_statistics_in_formats: [ OK ] 3.92 sec.
2026-10-29 02:23:37 00534_functions_bad_arguments11: [ OK ] 25.42 sec.
2026-10-29 02:23:37 00354_host_command_line_option: [ OK ] 2.46 sec.
2026-10-29 02:23:37 00346_if_tuple: [ OK ] 0.46 sec.
2026-10-29 02:23:37 00534_functions_bad_arguments8: [ OK ] 25.64 sec.
2026-10-29 02:23:37 00338_replicate_array_of_strings: [ OK ] 0.51 sec.
2026-10-29 02:23:37 00337_shard_any_heavy: [ OK ] 0.41 sec.
2026-10-29 02:23:38 00321_pk_set: [ OK ] 0.73 sec.
2026-10-29 02:23:38 00339_parsing_bad_arrays: [ OK ] 1.48 sec.
2026-10-29 02:23:39 00335_bom: [ OK ] 1.53 sec.
2026-10-29 02:23:39 00322_disable_checksumming: [ OK ] 1.26 sec.
2026-10-29 02:23:39 00311_array_primary_key: [ OK ] 0.92 sec.
2026-10-29 02:23:39 00298_enum_width_and_cast: [ OK ] 0.80 sec.
2026-10-29 02:23:39 00296_url_parameters: [ OK ] 0.83 sec.
2026-10-29 02:23:40 00299_stripe_log_multiple_inserts: [ OK ] 1.33 sec.
2026-10-29 02:23:40 00287_column_const_with_nan: [ OK ] 0.34 sec.
2026-10-29 02:23:40 00293_shard_max_subquery_depth: [ OK ] 1.16 sec.
2026-10-29 02:23:40 00271_agg_state_and_totals: [ OK ] 0.45 sec.
2026-10-29 02:23:41 00267_tuple_array_access_operators_priority: [ OK ] 0.56 sec.
2026-10-29 02:23:41 00263_merge_aggregates_and_overflow: [ OK ] 0.74 sec.
2026-10-29 02:23:42 00251_has_types: [ OK ] 0.93 sec.
2026-10-29 02:23:43 00262_alter_alias: [ OK ] 1.43 sec.
2026-10-29 02:23:43 00340_squashing_insert_select: [ OK ] 5.75 sec.
2026-10-29 02:23:43 00275_shard_quantiles_weighted: [ OK ] 2.91 sec.
2026-10-29 02:23:43 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.57 sec.
2026-10-29 02:23:43 00234_disjunctive_equality_chains_optimization: [ OK ] 0.49 sec.
2026-10-29 02:23:43 00229_prewhere_column_missing: [ OK ] 0.85 sec.
2026-10-29 02:23:43 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.57 sec.
2026-10-29 02:23:44 00218_like_regexp_newline: [ OK ] 0.43 sec.
2026-10-29 02:23:44 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.97 sec.
2026-10-29 02:23:44 00196_float32_formatting: [ OK ] 0.40 sec.
2026-10-29 02:23:44 00209_insert_select_extremes: [ OK ] 0.66 sec.
2026-10-29 02:23:44 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.63 sec.
2026-10-29 02:23:44 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.71 sec.
2026-10-29 02:23:45 00195_shard_union_all_and_global_in: [ OK ] 0.53 sec.
2026-10-29 02:23:45 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.40 sec.
2026-10-29 02:23:45 00191_aggregating_merge_tree_and_final: [ OK ] 0.56 sec.
2026-10-29 02:23:45 00180_attach_materialized_view: [ OK ] 0.72 sec.
2026-10-29 02:23:46 00169_join_constant_keys: [ OK ] 0.33 sec.
2026-10-29 02:23:46 00177_inserts_through_http_parts: [ OK ] 1.53 sec.
2026-10-29 02:23:46 00276_sample: [ OK ] 6.86 sec.
2026-10-29 02:23:46 00165_transform_non_const_default: [ OK ] 0.67 sec.
2026-10-29 02:23:46 00181_aggregate_functions_statistics_stable: [ OK ] 1.93 sec.
2026-10-29 02:23:47 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.41 sec.
2026-10-29 02:23:47 00151_tuple_with_array: [ OK ] 0.48 sec.
2026-10-29 02:23:47 00152_totals_in_subquery: [ OK ] 0.55 sec.
2026-10-29 02:23:47 00135_duplicate_group_by_keys_segfault: [ OK ] 0.31 sec.
2026-10-29 02:23:48 00143_number_classification_functions: [ OK ] 0.59 sec.
2026-10-29 02:23:48 00131_set_hashed: [ OK ] 0.35 sec.
2026-10-29 02:23:48 00161_rounding_functions: [ OK ] 1.37 sec.
2026-10-29 02:23:48 00122_join_with_subquery_with_subquery: [ OK ] 0.44 sec.
2026-10-29 02:23:49 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 25.54 sec.
2026-10-29 02:23:49 00118_storage_join: [ OK ] 0.76 sec.
2026-10-29 02:23:49 00098_g_union_all: [ OK ] 0.42 sec.
2026-10-29 02:23:49 00104_totals_having_mode: [ OK ] 1.24 sec.
2026-10-29 02:23:50 00098_shard_i_union_all: [ OK ] 0.80 sec.
2026-10-29 02:23:50 00098_1_union_all: [ OK ] 0.79 sec.
2026-10-29 02:23:51 00098_f_union_all: [ OK ] 0.82 sec.
2026-10-29 02:23:51 00098_j_union_all: [ OK ] 0.39 sec.
2026-10-29 02:23:51 00098_k_union_all: [ OK ] 0.50 sec.
2026-10-29 02:23:52 00100_subquery_table_identifier: [ OK ] 3.62 sec.
2026-10-29 02:23:53 00088_distinct_of_arrays_of_strings: [ OK ] 0.35 sec.
2026-10-29 02:23:53 00085_visible_width_of_tuple_of_dates: [ OK ] 0.66 sec.
2026-10-29 02:23:54 00080_show_tables_and_system_tables: [ OK ] 0.97 sec.
2026-10-29 02:23:55 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.52 sec.
2026-10-29 02:23:55 00072_in_types: [ OK ] 0.41 sec.
2026-10-29 02:23:56 00071_insert_fewer_columns: [ OK ] 0.88 sec.
2026-10-29 02:23:57 00066_group_by_in: [ OK ] 0.39 sec.
2026-10-29 02:23:57 00065_shard_float_literals_formatting: [ OK ] 0.56 sec.
2026-10-29 02:23:57 00148_summing_merge_tree_aggregate_function: [ OK ] 10.36 sec.
2026-10-29 02:23:58 00064_negate_bug: [ OK ] 0.36 sec.
2026-10-29 02:23:58 00063_check_query: [ OK ] 0.56 sec.
2026-10-29 02:23:58 00060_date_lut: [ OK ] 0.41 sec.
2026-10-29 02:23:58 00059_shard_global_in: [ OK ] 0.52 sec.
2026-10-29 02:23:59 00055_join_two_numbers: [ OK ] 0.42 sec.
2026-10-29 02:24:00 00053_all_inner_join: [ OK ] 0.53 sec.
2026-10-29 02:24:00 00059_shard_global_in_mergetree: [ OK ] 1.70 sec.
2026-10-29 02:24:00 00050_any_left_join: [ OK ] 0.41 sec.
2026-10-29 02:24:00 00024_unused_array_join_in_subquery: [ OK ] 0.34 sec.
2026-10-29 02:24:01 00022_func_higher_order_and_constants: [ OK ] 0.31 sec.
2026-10-29 02:24:01 00030_alter_table: [ OK ] 0.89 sec.
2026-10-29 02:24:02 00009_array_join_subquery: [ OK ] 0.59 sec.
2026-10-29 02:24:02 00008_array_join: [ OK ] 0.76 sec.
2026-10-29 02:24:02 00007_array: [ OK ] 0.39 sec.
2026-10-29 02:24:02 00004_shard_format_ast_and_remote_table: [ OK ] 0.39 sec.
2026-10-29 02:24:02 00003_reinterpret_as_string: [ OK ] 0.37 sec.
2026-10-29 02:24:02
2026-10-29 02:24:02 145 tests passed. 0 tests skipped. 529.13 s elapsed (ForkPoolWorker-9).
2026-10-29 02:24:03 00002_system_numbers: [ OK ] 0.49 sec.
2026-10-29 02:24:03
2026-10-29 02:24:03 206 tests passed. 2 tests skipped. 529.35 s elapsed (ForkPoolWorker-7).
2026-10-29 02:24:04 00113_shard_group_array: [ OK ] 15.71 sec.
2026-10-29 02:24:04
2026-10-29 02:24:04 178 tests passed. 0 tests skipped. 530.30 s elapsed (ForkPoolWorker-4).
2026-10-29 02:24:04 00411_long_accurate_number_comparison_int1: [ OK ] 38.39 sec.
2026-10-29 02:24:04
2026-10-29 02:24:04 Having 1 errors! 162 tests passed. 2 tests skipped. 530.36 s elapsed (ForkPoolWorker-2).
2026-10-29 02:24:09 00183_skip_unavailable_shards: [ OK ] 24.71 sec.
2026-10-29 02:24:09
2026-10-29 02:24:09 174 tests passed. 2 tests skipped. 535.76 s elapsed (ForkPoolWorker-6).
2026-10-29 02:24:21 00090_union_race_conditions_1: [ OK ] 29.95 sec.
2026-10-29 02:24:21
2026-10-29 02:24:21 179 tests passed. 0 tests skipped. 548.21 s elapsed (ForkPoolWorker-5).
2026-10-29 02:24:46 00097_long_storage_buffer_race_condition: [ OK ] 54.87 sec.
2026-10-29 02:24:46
2026-10-29 02:24:46 206 tests passed. 0 tests skipped. 572.60 s elapsed (ForkPoolWorker-3).
2026-10-29 02:25:15 00328_long_case_construction: [ OK ] 98.16 sec.
2026-10-29 02:25:15
2026-10-29 02:25:15 Having 1 errors! 171 tests passed. 1 tests skipped. 602.22 s elapsed (ForkPoolWorker-8).
2026-10-29 02:25:15
2026-10-29 02:25:15 Running 137 stateless tests (MainProcess).
2026-10-29 02:25:15
2026-10-29 02:25:20 02973_backup_of_in_memory_compressed: [ OK ] 4.84 sec.
2026-10-29 02:26:45 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 84.08 sec.
2026-10-29 02:26:45 02960_partition_by_udf: [ OK ] 0.82 sec.
2026-10-29 02:26:56 02944_dynamically_change_filesystem_cache_size: [ OK ] 10.32 sec.
2026-10-29 02:27:04 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 7.57 sec.
2026-10-29 02:27:05 02931_max_num_to_warn: [ OK ] 0.78 sec.
2026-10-29 02:27:10 02916_move_partition_inactive_replica: [ OK ] 5.60 sec.
2026-10-29 02:27:15 02915_move_partition_inactive_replica: [ OK ] 4.54 sec.
2026-10-29 02:27:16 02908_empty_named_collection: [ OK ] 0.45 sec.
2026-10-29 02:27:16 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.88 sec.
2026-10-29 02:27:39 02871_peak_threads_usage: [ OK ] 22.67 sec.
2026-10-29 02:27:54 02867_page_cache: [ OK ] 14.49 sec.
2026-10-29 02:28:02 02789_filesystem_cache_alignment: [ OK ] 8.50 sec.
2026-10-29 02:28:02 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:28:03 02762_replicated_database_no_args: [ OK ] 0.50 sec.
2026-10-29 02:28:05 02735_capnp_case_insensitive_names_matching: [ OK ] 2.00 sec.
2026-10-29 02:30:08 02735_parquet_encoder: [ OK ] 122.47 sec.
2026-10-29 02:30:38 02725_start_stop_fetches: [ OK ] 30.67 sec.
2026-10-29 02:31:07 02700_s3_part_INT_MAX: [ FAIL ] 7.58 sec. - return code: 241
2026-10-29 02:31:07 [8845d794fca2] 2026.10.28 16:31:06.939115 [ 8167 ] {a9f2e50a-a066-4272-9a34-39e44886a91a} executeQuery: Code: 241. DB::Exception: Memory limit (total) exceeded: would use 28.44 GiB (attempt to allocate chunk of 4294278631 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker. (MEMORY_LIMIT_EXCEEDED) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:59092) (comment: 02700_s3_part_INT_MAX.sh) (in query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_cvzrbpoh/test_INT_MAX.tsv', '', '[HIDDEN]', 'TSV') SETTINGS s3_max_single_part_upload_size = '10Gi' SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) SETTINGS s3_max_single_part_upload_size = '10Gi'), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:31:07
2026-10-29 02:31:07 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003a555553
2026-10-29 02:31:07 1. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001cb490b0
2026-10-29 02:31:07 2. ./contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception>>(int, FormatStringHelperImpl::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity>>::type>, char const*&&, char const*&&, String&&, long&, String&&, char const*&&, std::basic_string_view>&&) @ 0x000000001cba4091
2026-10-29 02:31:07 3. ./build_docker/./src/Common/MemoryTracker.cpp:340: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1759
2026-10-29 02:31:07 4. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:31:07 5. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:31:07 6. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:31:07 7. ./build_docker/./src/Common/CurrentMemoryTracker.cpp:59: CurrentMemoryTracker::alloc(long) @ 0x000000001caa7bdd
2026-10-29 02:31:07 8. ./build_docker/./src/Common/Allocator.cpp:0: Allocator::realloc(void*, unsigned long, unsigned long, unsigned long) @ 0x000000001caa3c53
2026-10-29 02:31:07 9. ./src/IO/BufferWithOwnMemory.h:101: DB::Memory>::resize(unsigned long) @ 0x000000001ccc0fca
2026-10-29 02:31:07 10. ./src/IO/BufferWithOwnMemory.h:80: DB::WriteBufferFromS3::reallocateFirstBuffer() @ 0x000000002ab8e22e
2026-10-29 02:31:07 11. ./src/IO/BufferBase.h:41: DB::WriteBufferFromS3::nextImpl() @ 0x000000002ab8d5ce
2026-10-29 02:31:07 12. DB::WriteBuffer::write(char const*, unsigned long) @ 0x000000000a8413cd
2026-10-29 02:31:07 13. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:0: DB::IRowOutputFormat::write(std::vector::immutable_ptr, std::allocator::immutable_ptr>> const&, unsigned long) @ 0x00000000328d01a2
2026-10-29 02:31:07 14. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:32: DB::IRowOutputFormat::consume(DB::Chunk) @ 0x00000000328cf77b
2026-10-29 02:31:07 15. ./build_docker/./src/Processors/Formats/IOutputFormat.cpp:0: DB::IOutputFormat::write(DB::Block const&) @ 0x00000000328ce9d0
2026-10-29 02:31:07 16. ./build_docker/./src/Storages/StorageS3.cpp:0: DB::StorageS3Sink::consume(DB::Chunk) @ 0x0000000030b89aaa
2026-10-29 02:31:07 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::SinkToStorage::onConsume(DB::Chunk) @ 0x000000003330ac6e
2026-10-29 02:31:07 18. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x00000000330994ac
2026-10-29 02:31:07 19. ./build_docker/./src/Processors/Transforms/ExceptionKeepingTransform.cpp:102: DB::runStep(std::function, DB::ThreadStatus*, std::atomic*) @ 0x0000000033098fa8
2026-10-29 02:31:07 20. ./contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000033097b97
2026-10-29 02:31:07 21. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x00000000328ab1ce
2026-10-29 02:31:07 22. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x000000003288bde3
2026-10-29 02:31:07 23. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:381: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x000000003288d006
2026-10-29 02:31:07 24. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001cd5773d
2026-10-29 02:31:07 25. ./src/Common/ThreadPool.h:226: ThreadFromGlobalPoolImpl::ThreadFromGlobalPoolImpl>::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>(void&&)::'lambda'()::operator()() @ 0x000000001cd617f3
2026-10-29 02:31:07 26. ./base/base/../base/wide_integer_impl.h:810: ThreadPoolImpl::worker(std::__list_iterator) @ 0x000000001cd4e740
2026-10-29 02:31:07 27. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15000]>, void ThreadPoolImpl::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>>(void*) @ 0x000000001cd5b94d
2026-10-29 02:31:07 28. asan_thread_start(void*) @ 0x000000000a7b9f1b
2026-10-29 02:31:07 29. ? @ 0x00007f8b20295ac3
2026-10-29 02:31:07 30. ? @ 0x00007f8b20327850
2026-10-29 02:31:07
2026-10-29 02:31:07 Received exception from server (version 24.3.18):
2026-10-29 02:31:07 Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 28.44 GiB (attempt to allocate chunk of 4294278631 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED)
2026-10-29 02:31:07 (query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_cvzrbpoh/test_INT_MAX.tsv', '', '', 'TSV')
2026-10-29 02:31:07 SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024)
2026-10-29 02:31:07 SETTINGS s3_max_single_part_upload_size = '10Gi';)
2026-10-29 02:31:07 , result:
2026-10-29 02:31:07
2026-10-29 02:31:07
2026-10-29 02:31:07
2026-10-29 02:31:07 stdout:
2026-10-29 02:31:07
2026-10-29 02:31:07
2026-10-29 02:31:07 Settings used in the test: --max_insert_threads 9 --group_by_two_level_threshold 312747 --group_by_two_level_threshold_bytes 43702561 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 19814255 --max_read_buffer_size 990619 --prefer_localhost_replica 1 --max_block_size 86075 --max_threads 55 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 94 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 40376245 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 18 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 1 --max_bytes_before_external_group_by 1 --max_bytes_before_remerge_sort 2262698818 --min_compress_block_size 1889668 --max_compress_block_size 2020501 --merge_tree_compact_parts_min_granules_to_multibuffer_read 124 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8529096 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone America/Hermosillo --prefer_warmed_unmerged_parts_seconds 8 --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.02
2026-10-29 02:31:07
2026-10-29 02:31:07 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.6670837049323313 --prefer_fetch_merged_part_size_threshold 4501731424 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 10 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 6849341 --merge_max_block_size 10339 --index_granularity 811 --min_bytes_for_wide_part 1026402691 --marks_compress_block_size 18741 --primary_key_compress_block_size 48654 --replace_long_file_name_to_hash 1 --max_file_name_length 15 --min_bytes_for_full_part_storage 290916327 --compact_parts_max_bytes_to_buffer 469703606 --compact_parts_max_granules_to_buffer 148 --compact_parts_merge_max_bytes_to_prefetch_part 10199581 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 225
2026-10-29 02:31:07
2026-10-29 02:31:07 Database: test_cvzrbpoh
2026-10-29 02:31:09 02541_arrow_duration_type: [ OK ] 2.15 sec.
2026-10-29 02:31:11 02522_avro_complicate_schema: [ OK ] 2.07 sec.
2026-10-29 02:31:22 02504_regexp_dictionary_ua_parser: [ OK ] 10.87 sec.
2026-10-29 02:31:27 02503_cache_on_write_with_small_segment_size: [ OK ] 5.18 sec.
2026-10-29 02:31:30 02501_deep_recusion_schema_inference: [ OK ] 2.26 sec.
2026-10-29 02:31:30 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:31:30 02494_query_cache_user_quotas_after_drop: [ OK ] 0.57 sec.
2026-10-29 02:31:31 02494_query_cache_compression: [ OK ] 0.77 sec.
2026-10-29 02:31:32 02494_query_cache_use_database: [ OK ] 0.58 sec.
2026-10-29 02:31:39 02494_query_cache_ttl_long: [ OK ] 6.64 sec.
2026-10-29 02:31:45 02494_trace_log_profile_events: [ OK ] 6.20 sec.
2026-10-29 02:31:46 02494_query_cache_bugs: [ OK ] 0.70 sec.
2026-10-29 02:31:47 02482_json_nested_arrays_with_same_keys: [ OK ] 1.77 sec.
2026-10-29 02:31:50 02458_hdfs_cluster_schema_inference: [ OK ] 2.10 sec.
2026-10-29 02:31:50 02422_msgpack_uuid_wrong_column: [ OK ] 0.57 sec.
2026-10-29 02:31:59 02421_record_errors_row_by_input_format: [ OK ] 8.54 sec.
2026-10-29 02:31:59 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.62 sec.
2026-10-29 02:32:01 02404_schema_inference_cache_respect_format_settings: [ OK ] 1.25 sec.
2026-10-29 02:32:01 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. - disabled
2026-10-29 02:32:03 02373_heap_buffer_overflow_in_avro: [ OK ] 2.30 sec.
2026-10-29 02:32:06 02350_views_max_insert_threads: [ OK ] 2.40 sec.
2026-10-29 02:32:08 02311_system_zookeeper_insert_priv: [ OK ] 2.44 sec.
2026-10-29 02:32:46 02286_mysql_dump_input_format: [ OK ] 38.19 sec.
2026-10-29 02:32:52 02262_column_ttl: [ OK ] 5.98 sec.
2026-10-29 02:33:02 02247_read_bools_as_numbers_json: [ OK ] 9.73 sec.
2026-10-29 02:33:03 02244_lowcardinality_hash_join: [ OK ] 0.52 sec.
2026-10-29 02:33:17 02242_system_filesystem_cache_log_table: [ OK ] 13.88 sec.
2026-10-29 02:33:30 02242_delete_user_race: [ OK ] 12.62 sec.
2026-10-29 02:33:30 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.83 sec.
2026-10-29 02:33:32 02240_filesystem_query_cache: [ OK ] 0.99 sec.
127.0.0.1 - - [28/Oct/2026:23:33:48 +0000] "PUT /devstoreaccount1/cont/pgjskzjwcucsptyvjyoaxrvvtozgvsdm?blockid=rmceucfnjxeclzohnsbomhouknjkufwjtcocslikedxbtpunewlsiqmolreyprpd&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:48 +0000] "PUT /devstoreaccount1/cont/pgjskzjwcucsptyvjyoaxrvvtozgvsdm?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/wusscqihgltartmetmwoltrxziimdkgc?blockid=esqjolwiidvqcypmodbdotpavzquiarorzjegggqeexmjacjbfhqhlsgrwwifpif&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/lsuiyuyuhksfytacvumiixveiskbzetb?blockid=wezkdvbcydbxvkaozcmdhrvygkdfblmoikknxcxqwhxwpwxdlxwihzvokuclwohb&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/lresznbfkbpkiellocewhuumzvhrlqac?blockid=oxaggeyllhsfcnmbhnargpquerjtrnlyekglcpmdqgifgsoybfmyghqkkeqogggx&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/frpkzymqnikwhvjvfvcgfznryjidjnfn?blockid=pzmtzdrokagtmikawmsiazsxgbhwpdzdkmmqmsjwbkgfvlwopmngnooahtpmdldt&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/fdwnkptsqirpifrvfxqbcluydpsswkzf?blockid=aiukqjzsufqyscacidopsdsjnjiaqidkpfufxbanxwthbshohnbjegeeldmwnybx&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/hsejkotdsvcpolhoniohysvrkchsafdx?blockid=xcwykqezfoyucrndllaavlddkgpeaevrpenibjztnrrkakwjmjmnsajiqveizmpd&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/btrtcnvxzfhytybtkqgywxsfqtqgwuxr?blockid=xooopdzhwqoryplmpketzhoqwrbqewnnagmsrlpoldvbucxlrqlyyxljdnwhtxlr&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/iglgisoozgmtdgiwfwfpnxyqevhvoluk?blockid=rfcqgxzlrwntdbrutcfdidflvjuxmuykzlsqwjrkprhqrxelskrlcdbxrtxificm&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/ulabhtixyixnqnvwhiilvwruztkkihua?blockid=icexukopfkskyeknpyhtxklouxucolnejuqftntxjchdlcfhrqajudifzwwagway&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/wusscqihgltartmetmwoltrxziimdkgc?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/lsuiyuyuhksfytacvumiixveiskbzetb?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/lresznbfkbpkiellocewhuumzvhrlqac?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/frpkzymqnikwhvjvfvcgfznryjidjnfn?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/fdwnkptsqirpifrvfxqbcluydpsswkzf?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/hsejkotdsvcpolhoniohysvrkchsafdx?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/btrtcnvxzfhytybtkqgywxsfqtqgwuxr?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/iglgisoozgmtdgiwfwfpnxyqevhvoluk?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "PUT /devstoreaccount1/cont/ulabhtixyixnqnvwhiilvwruztkkihua?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "GET /devstoreaccount1/cont/lsuiyuyuhksfytacvumiixveiskbzetb HTTP/1.1" 206 62
127.0.0.1 - - [28/Oct/2026:23:33:49 +0000] "GET /devstoreaccount1/cont/wusscqihgltartmetmwoltrxziimdkgc HTTP/1.1" 206 100099
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/cypgfpfyuowktlqkqtfzpzrlzrkhlikk?blockid=qrehktyosfrntmizrttvsxjysxplktzljvfaqbsphncksyyonydkveqzbwcngnxw&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/plmosksxgqgvctnqtjxudndssfkbkejb?blockid=ydnnhitssmibbasveudfdklbwouobbckwkevuchexocqfyunegpbjlcppawokhrc&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/ewinawjzwluspbdzjhlaysaydxvptuip?blockid=bcpykspbegouzqhjqjirjgtsdejxuktlwkjfmqeqjmiorlvmkqkaejkhdflbokrl&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/voehnmlgwvwujjwszvgexhjmxamyrohu?blockid=dyazeuhrufwkfwevzsfhkzydybpelidgannqsynvtqcolxhrsiubaraunzpdfusm&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/lmrkzbnhfibjcohdrupaivtdkbxhonrl?blockid=sppridwcagswgklzopsummnwblspoegcqffibcepglrdljzoeaejgkvzqkutfdug&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/gethsgdptmjpqrbsdjybtijyhlbhvhaj HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/qqztuqtwbjcaifkyavlynlkoqjsfqfjg HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/flsdviwlwsuwiezvrznqflvzzeayqeei HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/cypgfpfyuowktlqkqtfzpzrlzrkhlikk?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/plmosksxgqgvctnqtjxudndssfkbkejb?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/ewinawjzwluspbdzjhlaysaydxvptuip?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/voehnmlgwvwujjwszvgexhjmxamyrohu?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/lmrkzbnhfibjcohdrupaivtdkbxhonrl?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/ulabhtixyixnqnvwhiilvwruztkkihua HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/hsejkotdsvcpolhoniohysvrkchsafdx HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/frpkzymqnikwhvjvfvcgfznryjidjnfn HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/lsuiyuyuhksfytacvumiixveiskbzetb HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/wusscqihgltartmetmwoltrxziimdkgc HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/lresznbfkbpkiellocewhuumzvhrlqac HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/fdwnkptsqirpifrvfxqbcluydpsswkzf HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/iglgisoozgmtdgiwfwfpnxyqevhvoluk HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "DELETE /devstoreaccount1/cont/btrtcnvxzfhytybtkqgywxsfqtqgwuxr HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/odtchkympfkgkbycunnjzygkpohyazct?blockid=ylrwubwtwbmuqqxkhpkxugatmnfcusdiixhsiwyhgoenptsimhhaxjueeecdaaak&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/mptmktozaokdkdhjbulytbmjghfpkyjj?blockid=horozdtrjvjrytruitqezcwepiseafkthkteigbxolungsrmtgvwjgjihnmbzaig&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/iwnygcpwjacglmgvxvorknkbwjdmqnux?blockid=zwjvhljucqmpkxjnyqdvqbywpoflkoxexgowrcqvltyeerhlbwvkzftnxyqocrbb&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/xzgzivsqdactvnqnmbwshutsvaagrgyc?blockid=tylkjbvleudkdjyolngsohumavdosvhfkpbieacblupisocdjzenahsokpzcahpk&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/flbespsywuwomalwcpmvefplqabjasdh?blockid=zeygonqrmiidirkacdbzubwcifgxyfmbmzhmctdfeufhxgjkgridufxwvmcdbesc&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/qvjvyvuyxwuwhzcnsqzqfhjrgakfklyd?blockid=qmweassggzpkytwlnsmzwoayivzbqlqwvydgnadlbgjuospqtwndzfphbpzoxdvo&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/ofikaezfjaitynsmyrwdskjoqoviubbf?blockid=sahjyviwcifbfidhnpmkzgnwavpqghizvxnkhcoksrqovgiyyqbwnvwrgvadxoab&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/zmsnhlgrksttbuszoopukxwklmlfnbpo?blockid=ybgqoreurgdhenarycmraiwdcozknjaezhgfxaqnghjhdkjaszninqzsgfjenmtp&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/uzduyokjpexmyeuhxembvgmnrzftnagt?blockid=ppzbgynydrnvlkkjnnfxkkanocmhcxolhudfnphrzeezcuvorswltubfixahpecs&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/odtchkympfkgkbycunnjzygkpohyazct?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/mptmktozaokdkdhjbulytbmjghfpkyjj?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/iwnygcpwjacglmgvxvorknkbwjdmqnux?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/xzgzivsqdactvnqnmbwshutsvaagrgyc?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/flbespsywuwomalwcpmvefplqabjasdh?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/qvjvyvuyxwuwhzcnsqzqfhjrgakfklyd?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/ofikaezfjaitynsmyrwdskjoqoviubbf?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/zmsnhlgrksttbuszoopukxwklmlfnbpo?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:01 +0000] "PUT /devstoreaccount1/cont/uzduyokjpexmyeuhxembvgmnrzftnagt?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/lmrkzbnhfibjcohdrupaivtdkbxhonrl HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/plmosksxgqgvctnqtjxudndssfkbkejb HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/cypgfpfyuowktlqkqtfzpzrlzrkhlikk HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/qqztuqtwbjcaifkyavlynlkoqjsfqfjg HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/gethsgdptmjpqrbsdjybtijyhlbhvhaj HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/flsdviwlwsuwiezvrznqflvzzeayqeei HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/voehnmlgwvwujjwszvgexhjmxamyrohu HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/ewinawjzwluspbdzjhlaysaydxvptuip HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/uzduyokjpexmyeuhxembvgmnrzftnagt HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/qvjvyvuyxwuwhzcnsqzqfhjrgakfklyd HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/xzgzivsqdactvnqnmbwshutsvaagrgyc HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/mptmktozaokdkdhjbulytbmjghfpkyjj HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/odtchkympfkgkbycunnjzygkpohyazct HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/iwnygcpwjacglmgvxvorknkbwjdmqnux HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/flbespsywuwomalwcpmvefplqabjasdh HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/zmsnhlgrksttbuszoopukxwklmlfnbpo HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/ofikaezfjaitynsmyrwdskjoqoviubbf HTTP/1.1" 202 -
127.0.0.1 - - [28/Oct/2026:23:34:02 +0000] "DELETE /devstoreaccount1/cont/pgjskzjwcucsptyvjyoaxrvvtozgvsdm HTTP/1.1" 202 -
2026-10-29 02:34:02 02226_filesystem_cache_profile_events: [ OK ] 30.24 sec.
2026-10-29 02:34:04 02184_ipv6_parsing: [ OK ] 2.33 sec.
2026-10-29 02:34:07 02166_arrow_dictionary_inference: [ OK ] 2.51 sec.
2026-10-29 02:34:08 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 1.00 sec.
2026-10-29 02:34:17 02149_schema_inference_create_table_syntax: [ OK ] 8.99 sec.
2026-10-29 02:34:42 02149_schema_inference: [ OK ] 24.78 sec.
2026-10-29 02:34:43 02148_sql_user_defined_function_subquery: [ OK ] 0.57 sec.
2026-10-29 02:34:56 02129_skip_quoted_fields: [ OK ] 13.21 sec.
2026-10-29 02:35:10 02115_write_buffers_finalize: [ OK ] 14.34 sec.
2026-10-29 02:35:14 02105_table_function_file_partiotion_by: [ OK ] 3.40 sec.
2026-10-29 02:35:15 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.98 sec.
2026-10-29 02:35:16 02025_dictionary_view_different_db: [ OK ] 0.66 sec.
2026-10-29 02:35:16 02015_column_default_dict_get_identifier: [ OK ] 0.73 sec.
2026-10-29 02:35:21 02015_global_in_threads: [ OK ] 4.70 sec.
2026-10-29 02:35:23 01913_exact_rows_before_limit_full: [ OK ] 1.39 sec.
2026-10-29 02:35:25 01903_ssd_cache_dictionary_array_type: [ OK ] 2.72 sec.
2026-10-29 02:35:27 01901_test_attach_partition_from: [ OK ] 2.09 sec.
2026-10-29 02:35:36 01889_check_row_policy_defined_using_user_function: [ OK ] 8.02 sec.
2026-10-29 02:35:36 01850_dist_INSERT_preserve_error: [ OK ] 0.76 sec.
2026-10-29 02:35:37 01837_database_memory_ddl_dictionaries: [ OK ] 0.87 sec.
2026-10-29 02:35:38 01821_table_comment: [ OK ] 0.39 sec.
2026-10-29 02:35:39 01778_hierarchical_dictionaries: [ OK ] 1.63 sec.
2026-10-29 02:35:42 01754_direct_dictionary_complex_key: [ OK ] 2.91 sec.
2026-10-29 02:35:46 01737_clickhouse_server_wait_server_pool_long: [ OK ] 4.02 sec.
2026-10-29 02:35:47 01721_engine_file_truncate_on_insert: [ OK ] 0.86 sec.
2026-10-29 02:36:01 01710_projection_vertical_merges: [ OK ] 13.17 sec.
2026-10-29 02:36:02 01681_cache_dictionary_simple_key: [ OK ] 1.58 sec.
2026-10-29 02:36:03 01676_range_hashed_dictionary: [ OK ] 1.22 sec.
2026-10-29 02:36:04 01646_system_restart_replicas_smoke: [ OK ] 0.88 sec.
2026-10-29 02:36:05 01603_rename_overwrite_bug: [ OK ] 1.02 sec.
2026-10-29 02:37:07 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 61.95 sec.
2026-10-29 02:37:08 01575_disable_detach_table_of_dictionary: [ OK ] 0.48 sec.
2026-10-29 02:37:10 01527_clickhouse_local_optimize: [ OK ] 2.39 sec.
2026-10-29 02:37:14 01524_do_not_merge_across_partitions_select_final: [ OK ] 3.35 sec.
2026-10-29 02:37:16 01474_executable_dictionary: [ OK ] 1.83 sec.
2026-10-29 02:37:17 01471_calculate_ttl_during_merge: [ OK ] 0.79 sec.
2026-10-29 02:37:42 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 25.28 sec.
2026-10-29 02:38:41 01459_manual_write_to_replicas: [ OK ] 59.22 sec.
2026-10-29 02:38:53 01444_create_table_drop_database_race: [ OK ] 11.98 sec.
2026-10-29 02:41:38 01442_merge_detach_attach_long: [ OK ] 164.24 sec.
2026-10-29 02:42:12 01415_sticking_mutations: [ OK ] 34.01 sec.
2026-10-29 02:42:28 01414_mutations_and_errors_zookeeper: [ OK ] 15.90 sec.
2026-10-29 02:42:38 01410_nullable_key_more_tests: [ OK ] 10.53 sec.
2026-10-29 02:42:39 01392_column_resolve: [ OK ] 0.98 sec.
2026-10-29 02:42:48 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 8.99 sec.
2026-10-29 02:42:53 01360_materialized_view_with_join_on_query_log: [ OK ] 4.54 sec.
2026-10-29 02:42:55 01356_view_threads: [ OK ] 1.70 sec.
2026-10-29 02:43:10 01338_long_select_and_alter_zookeeper: [ OK ] 15.47 sec.
2026-10-29 02:43:22 01305_replica_create_drop_zookeeper: [ OK ] 12.26 sec.
2026-10-29 02:43:57 01301_aggregate_state_exception_memory_leak: [ OK ] 34.16 sec.
2026-10-29 02:43:59 01297_create_quota: [ OK ] 2.22 sec.
2026-10-29 02:44:00 01295_create_row_policy: [ OK ] 1.14 sec.
2026-10-29 02:44:01 01294_system_distributed_on_cluster: [ OK ] 0.64 sec.
2026-10-29 02:44:01 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.63 sec.
2026-10-29 02:44:37 01275_parallel_mv: [ OK ] 35.37 sec.
2026-10-29 02:44:38 01272_suspicious_codecs: [ OK ] 1.29 sec.
2026-10-29 02:44:39 01225_show_create_table_from_dictionary: [ OK ] 0.42 sec.
2026-10-29 02:45:21 01192_rename_database_zookeeper: [ OK ] 41.75 sec.
2026-10-29 02:45:21 01188_attach_table_from_path: [ OK ] 0.75 sec.
2026-10-29 02:45:22 01164_alter_memory_database: [ OK ] 0.69 sec.
2026-10-29 02:45:23 01125_dict_ddl_cannot_add_column: [ OK ] 0.54 sec.
2026-10-29 02:45:24 01110_dictionary_layout_without_arguments: [ OK ] 0.58 sec.
2026-10-29 02:45:25 01103_distributed_product_mode_local_column_renames: [ OK ] 1.24 sec.
2026-10-29 02:45:50 01098_msgpack_format: [ OK ] 24.90 sec.
2026-10-29 02:45:54 01091_num_threads: [ OK ] 4.53 sec.
2026-10-29 02:46:44 01083_expressions_in_engine_arguments: [ OK ] 49.46 sec.
2026-10-29 02:46:46 01070_materialize_ttl: [ OK ] 2.15 sec.
2026-10-29 02:46:48 01070_mutations_with_dependencies: [ OK ] 2.15 sec.
2026-10-29 02:46:52 01070_modify_ttl: [ OK ] 3.12 sec.
2026-10-29 02:46:58 01053_ssd_dictionary: [ OK ] 6.14 sec.
2026-10-29 02:47:15 01040_dictionary_invalidate_query_switchover_long: [ OK ] 17.54 sec.
2026-10-29 02:47:25 01038_dictionary_lifetime_min_zero_sec: [ OK ] 9.99 sec.
2026-10-29 02:47:26 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.99 sec.
2026-10-29 02:47:27 01023_materialized_view_query_context: [ OK ] 0.72 sec.
2026-10-29 02:47:41 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 14.11 sec.
2026-10-29 02:47:47 01018_ddl_dictionaries_bad_queries: [ OK ] 5.15 sec.
2026-10-29 02:48:21 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 34.72 sec.
2026-10-29 02:48:26 01013_sync_replica_timeout_zookeeper: [ OK ] 4.19 sec.
2026-10-29 02:48:27 00971_query_id_in_logs: [ OK ] 1.89 sec.
2026-10-29 02:48:28 00963_achimbab: [ OK ] 0.96 sec.
2026-10-29 02:48:31 00950_dict_get: [ OK ] 2.23 sec.
2026-10-29 02:48:31 00910_buffer_prewhere: [ OK ] 0.59 sec.
2026-10-29 02:48:31 00877_memory_limit_for_new_delete: [ SKIPPED ] 0.00 sec. - not running for current build
2026-10-29 02:50:35 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 123.58 sec.
2026-10-29 02:50:37 00722_inner_join: [ OK ] 1.37 sec.
2026-10-29 02:50:38 00693_max_block_size_system_tables_columns: [ OK ] 1.21 sec.
2026-10-29 02:50:40 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 2.46 sec.
2026-10-29 02:51:08 00002_log_and_exception_messages_formatting: [ OK ] 28.06 sec.
2026-10-29 02:51:08
2026-10-29 02:51:08 Having 1 errors! 132 tests passed. 4 tests skipped. 1553.02 s elapsed (MainProcess).
2026-10-29 02:51:09 Won't run stateful tests because test data wasn't loaded.
2026-10-29 02:51:09 Checking the hung queries: done
2026-10-29 02:51:09
2026-10-29 02:51:09 No queries hung.
2026-10-29 02:51:09
2026-10-29 02:51:09 Some tests were restarted:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 02700_s3_part_INT_MAX :
2026-10-29 02:51:09 [ fail ] 5.33 sec. - return code: 241
2026-10-29 02:51:09 [8845d794fca2] 2026.10.28 16:30:43.906770 [ 69219 ] {65da9c1c-3520-4e50-9821-99e59822193c} executeQuery: Code: 241. DB::Exception: Memory limit (total) exceeded: would use 28.16 GiB (attempt to allocate chunk of 2146794983 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker. (MEMORY_LIMIT_EXCEEDED) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:56914) (comment: 02700_s3_part_INT_MAX.sh) (in query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_f4zf4h7h/test_INT_MAX.tsv', '', '[HIDDEN]', 'TSV') SETTINGS s3_max_single_part_upload_size = '10Gi' SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) SETTINGS s3_max_single_part_upload_size = '10Gi'), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:09
2026-10-29 02:51:09 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003a555553
2026-10-29 02:51:09 1. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001cb490b0
2026-10-29 02:51:09 2. ./contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception>>(int, FormatStringHelperImpl::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity>>::type>, char const*&&, char const*&&, String&&, long&, String&&, char const*&&, std::basic_string_view>&&) @ 0x000000001cba4091
2026-10-29 02:51:09 3. ./build_docker/./src/Common/MemoryTracker.cpp:340: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1759
2026-10-29 02:51:09 4. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 5. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 6. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 7. ./build_docker/./src/Common/CurrentMemoryTracker.cpp:59: CurrentMemoryTracker::alloc(long) @ 0x000000001caa7bdd
2026-10-29 02:51:09 8. ./build_docker/./src/Common/Allocator.cpp:0: Allocator::realloc(void*, unsigned long, unsigned long, unsigned long) @ 0x000000001caa3c53
2026-10-29 02:51:09 9. ./src/IO/BufferWithOwnMemory.h:101: DB::Memory>::resize(unsigned long) @ 0x000000001ccc0fca
2026-10-29 02:51:09 10. ./src/IO/BufferWithOwnMemory.h:80: DB::WriteBufferFromS3::reallocateFirstBuffer() @ 0x000000002ab8e22e
2026-10-29 02:51:09 11. ./src/IO/BufferBase.h:41: DB::WriteBufferFromS3::nextImpl() @ 0x000000002ab8d5ce
2026-10-29 02:51:09 12. DB::WriteBuffer::write(char) @ 0x000000000a841919
2026-10-29 02:51:09 13. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:32: DB::IRowOutputFormat::consume(DB::Chunk) @ 0x00000000328cf77b
2026-10-29 02:51:09 14. ./build_docker/./src/Processors/Formats/IOutputFormat.cpp:0: DB::IOutputFormat::write(DB::Block const&) @ 0x00000000328ce9d0
2026-10-29 02:51:09 15. ./build_docker/./src/Storages/StorageS3.cpp:0: DB::StorageS3Sink::consume(DB::Chunk) @ 0x0000000030b89aaa
2026-10-29 02:51:09 16. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::SinkToStorage::onConsume(DB::Chunk) @ 0x000000003330ac6e
2026-10-29 02:51:09 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x00000000330994ac
2026-10-29 02:51:09 18. ./build_docker/./src/Processors/Transforms/ExceptionKeepingTransform.cpp:102: DB::runStep(std::function, DB::ThreadStatus*, std::atomic*) @ 0x0000000033098fa8
2026-10-29 02:51:09 19. ./contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000033097b97
2026-10-29 02:51:09 20. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x00000000328ab1ce
2026-10-29 02:51:09 21. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x000000003288bde3
2026-10-29 02:51:09 22. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:381: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x000000003288d006
2026-10-29 02:51:09 23. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001cd5773d
2026-10-29 02:51:09 24. ./src/Common/ThreadPool.h:226: ThreadFromGlobalPoolImpl::ThreadFromGlobalPoolImpl>::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>(void&&)::'lambda'()::operator()() @ 0x000000001cd617f3
2026-10-29 02:51:09 25. ./base/base/../base/wide_integer_impl.h:810: ThreadPoolImpl::worker(std::__list_iterator) @ 0x000000001cd4e740
2026-10-29 02:51:09 26. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15000]>, void ThreadPoolImpl::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>>(void*) @ 0x000000001cd5b94d
2026-10-29 02:51:09 27. asan_thread_start(void*) @ 0x000000000a7b9f1b
2026-10-29 02:51:09 28. ? @ 0x00007f8b20295ac3
2026-10-29 02:51:09 29. ? @ 0x00007f8b20327850
2026-10-29 02:51:09
2026-10-29 02:51:09 Received exception from server (version 24.3.18):
2026-10-29 02:51:09 Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 28.16 GiB (attempt to allocate chunk of 2146794983 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED)
2026-10-29 02:51:09 (query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_f4zf4h7h/test_INT_MAX.tsv', '', '', 'TSV')
2026-10-29 02:51:09 SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024)
2026-10-29 02:51:09 SETTINGS s3_max_single_part_upload_size = '10Gi';)
2026-10-29 02:51:09 , result:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 stdout:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 Settings used in the test: --max_insert_threads 9 --group_by_two_level_threshold 312747 --group_by_two_level_threshold_bytes 43702561 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 19814255 --max_read_buffer_size 990619 --prefer_localhost_replica 1 --max_block_size 86075 --max_threads 55 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 94 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 40376245 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 18 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 1 --max_bytes_before_external_group_by 1 --max_bytes_before_remerge_sort 2262698818 --min_compress_block_size 1889668 --max_compress_block_size 2020501 --merge_tree_compact_parts_min_granules_to_multibuffer_read 124 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8529096 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone America/Hermosillo --prefer_warmed_unmerged_parts_seconds 8 --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.02
2026-10-29 02:51:09
2026-10-29 02:51:09 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.6670837049323313 --prefer_fetch_merged_part_size_threshold 4501731424 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 10 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 6849341 --merge_max_block_size 10339 --index_granularity 811 --min_bytes_for_wide_part 1026402691 --marks_compress_block_size 18741 --primary_key_compress_block_size 48654 --replace_long_file_name_to_hash 1 --max_file_name_length 15 --min_bytes_for_full_part_storage 290916327 --compact_parts_max_bytes_to_buffer 469703606 --compact_parts_max_granules_to_buffer 148 --compact_parts_merge_max_bytes_to_prefetch_part 10199581 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 225
2026-10-29 02:51:09
2026-10-29 02:51:09 Database: test_f4zf4h7h
2026-10-29 02:51:09
2026-10-29 02:51:09 02700_s3_part_INT_MAX :
2026-10-29 02:51:09 [ fail ] 7.62 sec. - return code: 241
2026-10-29 02:51:09 [8845d794fca2] 2026.10.28 16:30:51.967305 [ 8167 ] {1c2e4f59-ad63-4d55-ba45-ef48322a3343} executeQuery: Code: 241. DB::Exception: Memory limit (total) exceeded: would use 28.47 GiB (attempt to allocate chunk of 4294278631 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker. (MEMORY_LIMIT_EXCEEDED) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:56918) (comment: 02700_s3_part_INT_MAX.sh) (in query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_isdbxi11/test_INT_MAX.tsv', '', '[HIDDEN]', 'TSV') SETTINGS s3_max_single_part_upload_size = '10Gi' SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) SETTINGS s3_max_single_part_upload_size = '10Gi'), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:09
2026-10-29 02:51:09 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003a555553
2026-10-29 02:51:09 1. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001cb490b0
2026-10-29 02:51:09 2. ./contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception>>(int, FormatStringHelperImpl::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity>>::type>, char const*&&, char const*&&, String&&, long&, String&&, char const*&&, std::basic_string_view>&&) @ 0x000000001cba4091
2026-10-29 02:51:09 3. ./build_docker/./src/Common/MemoryTracker.cpp:340: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1759
2026-10-29 02:51:09 4. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 5. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 6. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 7. ./build_docker/./src/Common/CurrentMemoryTracker.cpp:59: CurrentMemoryTracker::alloc(long) @ 0x000000001caa7bdd
2026-10-29 02:51:09 8. ./build_docker/./src/Common/Allocator.cpp:0: Allocator::realloc(void*, unsigned long, unsigned long, unsigned long) @ 0x000000001caa3c53
2026-10-29 02:51:09 9. ./src/IO/BufferWithOwnMemory.h:101: DB::Memory>::resize(unsigned long) @ 0x000000001ccc0fca
2026-10-29 02:51:09 10. ./src/IO/BufferWithOwnMemory.h:80: DB::WriteBufferFromS3::reallocateFirstBuffer() @ 0x000000002ab8e22e
2026-10-29 02:51:09 11. ./src/IO/BufferBase.h:41: DB::WriteBufferFromS3::nextImpl() @ 0x000000002ab8d5ce
2026-10-29 02:51:09 12. DB::WriteBuffer::write(char const*, unsigned long) @ 0x000000000a8413cd
2026-10-29 02:51:09 13. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:0: DB::IRowOutputFormat::write(std::vector::immutable_ptr, std::allocator::immutable_ptr>> const&, unsigned long) @ 0x00000000328d01a2
2026-10-29 02:51:09 14. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:32: DB::IRowOutputFormat::consume(DB::Chunk) @ 0x00000000328cf77b
2026-10-29 02:51:09 15. ./build_docker/./src/Processors/Formats/IOutputFormat.cpp:0: DB::IOutputFormat::write(DB::Block const&) @ 0x00000000328ce9d0
2026-10-29 02:51:09 16. ./build_docker/./src/Storages/StorageS3.cpp:0: DB::StorageS3Sink::consume(DB::Chunk) @ 0x0000000030b89aaa
2026-10-29 02:51:09 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::SinkToStorage::onConsume(DB::Chunk) @ 0x000000003330ac6e
2026-10-29 02:51:09 18. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x00000000330994ac
2026-10-29 02:51:09 19. ./build_docker/./src/Processors/Transforms/ExceptionKeepingTransform.cpp:102: DB::runStep(std::function, DB::ThreadStatus*, std::atomic*) @ 0x0000000033098fa8
2026-10-29 02:51:09 20. ./contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000033097b97
2026-10-29 02:51:09 21. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x00000000328ab1ce
2026-10-29 02:51:09 22. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x000000003288bde3
2026-10-29 02:51:09 23. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:381: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x000000003288d006
2026-10-29 02:51:09 24. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001cd5773d
2026-10-29 02:51:09 25. ./src/Common/ThreadPool.h:226: ThreadFromGlobalPoolImpl::ThreadFromGlobalPoolImpl>::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>(void&&)::'lambda'()::operator()() @ 0x000000001cd617f3
2026-10-29 02:51:09 26. ./base/base/../base/wide_integer_impl.h:810: ThreadPoolImpl::worker(std::__list_iterator) @ 0x000000001cd4e740
2026-10-29 02:51:09 27. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15000]>, void ThreadPoolImpl::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>>(void*) @ 0x000000001cd5b94d
2026-10-29 02:51:09 28. asan_thread_start(void*) @ 0x000000000a7b9f1b
2026-10-29 02:51:09 29. ? @ 0x00007f8b20295ac3
2026-10-29 02:51:09 30. ? @ 0x00007f8b20327850
2026-10-29 02:51:09
2026-10-29 02:51:09 Received exception from server (version 24.3.18):
2026-10-29 02:51:09 Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 28.47 GiB (attempt to allocate chunk of 4294278631 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED)
2026-10-29 02:51:09 (query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_isdbxi11/test_INT_MAX.tsv', '', '', 'TSV')
2026-10-29 02:51:09 SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024)
2026-10-29 02:51:09 SETTINGS s3_max_single_part_upload_size = '10Gi';)
2026-10-29 02:51:09 , result:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 stdout:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 Settings used in the test: --max_insert_threads 9 --group_by_two_level_threshold 312747 --group_by_two_level_threshold_bytes 43702561 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 19814255 --max_read_buffer_size 990619 --prefer_localhost_replica 1 --max_block_size 86075 --max_threads 55 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 94 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 40376245 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 18 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 1 --max_bytes_before_external_group_by 1 --max_bytes_before_remerge_sort 2262698818 --min_compress_block_size 1889668 --max_compress_block_size 2020501 --merge_tree_compact_parts_min_granules_to_multibuffer_read 124 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8529096 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone America/Hermosillo --prefer_warmed_unmerged_parts_seconds 8 --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.02
2026-10-29 02:51:09
2026-10-29 02:51:09 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.6670837049323313 --prefer_fetch_merged_part_size_threshold 4501731424 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 10 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 6849341 --merge_max_block_size 10339 --index_granularity 811 --min_bytes_for_wide_part 1026402691 --marks_compress_block_size 18741 --primary_key_compress_block_size 48654 --replace_long_file_name_to_hash 1 --max_file_name_length 15 --min_bytes_for_full_part_storage 290916327 --compact_parts_max_bytes_to_buffer 469703606 --compact_parts_max_granules_to_buffer 148 --compact_parts_merge_max_bytes_to_prefetch_part 10199581 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 225
2026-10-29 02:51:09
2026-10-29 02:51:09 Database: test_isdbxi11
2026-10-29 02:51:09
2026-10-29 02:51:09 02700_s3_part_INT_MAX :
2026-10-29 02:51:09 [ fail ] 7.22 sec. - return code: 241
2026-10-29 02:51:09 [8845d794fca2] 2026.10.28 16:30:59.266676 [ 69219 ] {0bf3a197-bd74-40fe-9556-ae69558a4097} executeQuery: Code: 241. DB::Exception: Memory limit (total) exceeded: would use 28.91 GiB (attempt to allocate chunk of 4294278631 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker. (MEMORY_LIMIT_EXCEEDED) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:44146) (comment: 02700_s3_part_INT_MAX.sh) (in query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_y8tzfugj/test_INT_MAX.tsv', '', '[HIDDEN]', 'TSV') SETTINGS s3_max_single_part_upload_size = '10Gi' SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) SETTINGS s3_max_single_part_upload_size = '10Gi'), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:09
2026-10-29 02:51:09 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003a555553
2026-10-29 02:51:09 1. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001cb490b0
2026-10-29 02:51:09 2. ./contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception>>(int, FormatStringHelperImpl::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity>>::type>, char const*&&, char const*&&, String&&, long&, String&&, char const*&&, std::basic_string_view>&&) @ 0x000000001cba4091
2026-10-29 02:51:09 3. ./build_docker/./src/Common/MemoryTracker.cpp:340: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1759
2026-10-29 02:51:09 4. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 5. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 6. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001cba1114
2026-10-29 02:51:09 7. ./build_docker/./src/Common/CurrentMemoryTracker.cpp:59: CurrentMemoryTracker::alloc(long) @ 0x000000001caa7bdd
2026-10-29 02:51:09 8. ./build_docker/./src/Common/Allocator.cpp:0: Allocator::realloc(void*, unsigned long, unsigned long, unsigned long) @ 0x000000001caa3c53
2026-10-29 02:51:09 9. ./src/IO/BufferWithOwnMemory.h:101: DB::Memory>::resize(unsigned long) @ 0x000000001ccc0fca
2026-10-29 02:51:09 10. ./src/IO/BufferWithOwnMemory.h:80: DB::WriteBufferFromS3::reallocateFirstBuffer() @ 0x000000002ab8e22e
2026-10-29 02:51:09 11. ./src/IO/BufferBase.h:41: DB::WriteBufferFromS3::nextImpl() @ 0x000000002ab8d5ce
2026-10-29 02:51:09 12. DB::WriteBuffer::write(char const*, unsigned long) @ 0x000000000a8413cd
2026-10-29 02:51:09 13. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:0: DB::IRowOutputFormat::write(std::vector::immutable_ptr, std::allocator::immutable_ptr>> const&, unsigned long) @ 0x00000000328d01a2
2026-10-29 02:51:09 14. ./build_docker/./src/Processors/Formats/IRowOutputFormat.cpp:32: DB::IRowOutputFormat::consume(DB::Chunk) @ 0x00000000328cf77b
2026-10-29 02:51:09 15. ./build_docker/./src/Processors/Formats/IOutputFormat.cpp:0: DB::IOutputFormat::write(DB::Block const&) @ 0x00000000328ce9d0
2026-10-29 02:51:09 16. ./build_docker/./src/Storages/StorageS3.cpp:0: DB::StorageS3Sink::consume(DB::Chunk) @ 0x0000000030b89aaa
2026-10-29 02:51:09 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::SinkToStorage::onConsume(DB::Chunk) @ 0x000000003330ac6e
2026-10-29 02:51:09 18. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x00000000330994ac
2026-10-29 02:51:09 19. ./build_docker/./src/Processors/Transforms/ExceptionKeepingTransform.cpp:102: DB::runStep(std::function, DB::ThreadStatus*, std::atomic*) @ 0x0000000033098fa8
2026-10-29 02:51:09 20. ./contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000033097b97
2026-10-29 02:51:09 21. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x00000000328ab1ce
2026-10-29 02:51:09 22. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x000000003288bde3
2026-10-29 02:51:09 23. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:381: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_storage const*) @ 0x000000003288d006
2026-10-29 02:51:09 24. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001cd5773d
2026-10-29 02:51:09 25. ./src/Common/ThreadPool.h:226: ThreadFromGlobalPoolImpl::ThreadFromGlobalPoolImpl>::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>(void&&)::'lambda'()::operator()() @ 0x000000001cd617f3
2026-10-29 02:51:09 26. ./base/base/../base/wide_integer_impl.h:810: ThreadPoolImpl::worker(std::__list_iterator) @ 0x000000001cd4e740
2026-10-29 02:51:09 27. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15000]>, void ThreadPoolImpl::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>>(void*) @ 0x000000001cd5b94d
2026-10-29 02:51:09 28. asan_thread_start(void*) @ 0x000000000a7b9f1b
2026-10-29 02:51:09 29. ? @ 0x00007f8b20295ac3
2026-10-29 02:51:09 30. ? @ 0x00007f8b20327850
2026-10-29 02:51:09
2026-10-29 02:51:09 Received exception from server (version 24.3.18):
2026-10-29 02:51:09 Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 28.91 GiB (attempt to allocate chunk of 4294278631 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED)
2026-10-29 02:51:09 (query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_y8tzfugj/test_INT_MAX.tsv', '', '', 'TSV')
2026-10-29 02:51:09 SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024)
2026-10-29 02:51:09 SETTINGS s3_max_single_part_upload_size = '10Gi';)
2026-10-29 02:51:09 , result:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 stdout:
2026-10-29 02:51:09
2026-10-29 02:51:09
2026-10-29 02:51:09 Settings used in the test: --max_insert_threads 9 --group_by_two_level_threshold 312747 --group_by_two_level_threshold_bytes 43702561 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 19814255 --max_read_buffer_size 990619 --prefer_localhost_replica 1 --max_block_size 86075 --max_threads 55 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 94 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 40376245 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 18 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 1 --max_bytes_before_external_group_by 1 --max_bytes_before_remerge_sort 2262698818 --min_compress_block_size 1889668 --max_compress_block_size 2020501 --merge_tree_compact_parts_min_granules_to_multibuffer_read 124 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8529096 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone America/Hermosillo --prefer_warmed_unmerged_parts_seconds 8 --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.02
2026-10-29 02:51:09
2026-10-29 02:51:09 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.6670837049323313 --prefer_fetch_merged_part_size_threshold 4501731424 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 10 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 6849341 --merge_max_block_size 10339 --index_granularity 811 --min_bytes_for_wide_part 1026402691 --marks_compress_block_size 18741 --primary_key_compress_block_size 48654 --replace_long_file_name_to_hash 1 --max_file_name_length 15 --min_bytes_for_full_part_storage 290916327 --compact_parts_max_bytes_to_buffer 469703606 --compact_parts_max_granules_to_buffer 148 --compact_parts_merge_max_bytes_to_prefetch_part 10199581 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 225
2026-10-29 02:51:09
2026-10-29 02:51:15 Database: test_y8tzfugj
2026-10-29 02:51:15 All tests have finished.
2026-10-29 02:51:15
2026-10-29 02:51:15 Top patterns of log messages:
2026-10-29 02:51:15
2026-10-29 02:51:15 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-10-29 02:51:15
2026-10-29 02:51:15 1. 59984 0.058 3.41 MiB 0.025 5 838 ['Trace'] 0.001 Access granted: {}{}
2026-10-29 02:51:15 2. 51321 0.049 10.00 MiB 0.073 1 116 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2026-10-29 02:51:15 3. 51312 0.049 7.68 MiB 0.056 3 115 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2026-10-29 02:51:15 4. 41570 0.04 14.24 MiB 0.104 1 619 ['Trace'] 0.002 Query {} to stage {}{}
2026-10-29 02:51:15 5. 41386 0.04 1.14 MiB 0.008 1 115 ['Debug'] 0 Processed in {} sec.
2026-10-29 02:51:15 6. 41086 0.04 14.98 MiB 0.109 1 619 ['Trace'] 0.002 Query {} from stage {} to stage {}{}
2026-10-29 02:51:15 7. 33932 0.033 2.95 MiB 0.021 1 1730 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-10-29 02:51:15 8. 29762 0.029 897.04 KiB 0.006 1 1729 ['Trace'] 0 Aggregation method: {}
2026-10-29 02:51:15 9. 29511 0.028 2.31 MiB 0.017 1 112 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2026-10-29 02:51:15 10. 29456 0.028 1.29 MiB 0.009 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2026-10-29 02:51:15 11. 20211 0.019 1.61 MiB 0.012 4 198 ['Debug'] 0.996 {} Authenticating user '{}' from {}
2026-10-29 02:51:15 12. 20206 0.019 2.22 MiB 0.016 4 198 ['Debug'] 0.996 {} Authenticated with global context as user {}
2026-10-29 02:51:15 13. 20174 0.019 1.73 MiB 0.013 4 190 ['Debug'] 0.996 {} Logout, user_id: {}
2026-10-29 02:51:15 14. 20028 0.019 2.14 MiB 0.016 3 115 ['Debug'] 1 {} Creating session context with user_id: {}
2026-10-29 02:51:15 15. 18381 0.018 1.28 MiB 0.009 1 1879 ['Trace'] 0.485 Reserved {} on local disk {}, having unreserved {}.
2026-10-29 02:51:15 16. 18230 0.018 1.45 MiB 0.011 1 1630 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2026-10-29 02:51:15 17. 16104 0.015 2.08 MiB 0.015 1 2 ['Trace'] 1 Creating part at path {}
2026-10-29 02:51:15 18. 15389 0.015 720.43 KiB 0.005 1 138 ['Debug'] 0.183 Peak memory usage{}: {}.
2026-10-29 02:51:15 19. 13768 0.013 147.90 KiB 0.001 1 1659 ['Trace'] 0.001 Aggregating
2026-10-29 02:51:15 20. 13544 0.013 1.55 MiB 0.011 958 858 ['Trace'] 0.402 Renaming temporary part {} to {} with tid {}.
2026-10-29 02:51:15 21. 13170 0.013 913.24 KiB 0.006 950 1587 ['Trace'] 0.561 Trying to reserve {} using storage policy from min volume index {}
2026-10-29 02:51:15 22. 12055 0.012 570.13 KiB 0.004 1 1123 ['Trace'] 0.301 filled checksums {}
2026-10-29 02:51:15 23. 11719 0.011 2.17 MiB 0.016 3 106 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2026-10-29 02:51:15 24. 11715 0.011 8.58 MiB 0.062 2 106 ['Trace'] 1 Request URI: {}
2026-10-29 02:51:15 25. 11177 0.011 229.22 KiB 0.002 2 106 ['Debug'] 0.162 Done processing query
2026-10-29 02:51:15 26. 10723 0.01 348.96 KiB 0.002 2 115 ['Trace'] 1 TCP Request. Address: {}
2026-10-29 02:51:15 27. 10723 0.01 1.02 MiB 0.007 1 115 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2026-10-29 02:51:15 28. 10668 0.01 281.29 KiB 0.002 1 107 ['Debug'] 1 Done processing connection.
2026-10-29 02:51:15 29. 9664 0.009 217.06 KiB 0.002 1 1543 ['Trace'] 0.001 Merging aggregated data
2026-10-29 02:51:15 30. 9351 0.009 752.45 KiB 0.005 676 112 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2026-10-29 02:51:15 31. 7054 0.007 662.92 KiB 0.005 1 47 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2026-10-29 02:51:15 32. 7012 0.007 286.15 KiB 0.002 779 141 ['Debug'] 0.007 Key condition: {}
2026-10-29 02:51:15 33. 6631 0.006 755.90 KiB 0.005 772 141 ['Debug'] 0.007 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2026-10-29 02:51:15 34. 6362 0.006 544.64 KiB 0.004 273 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2026-10-29 02:51:15 35. 6010 0.006 311.06 KiB 0.002 693 135 ['Trace'] 0.008 Spreading mark ranges among streams (default reading)
2026-10-29 02:51:15 36. 6000 0.006 833.28 KiB 0.006 171 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2026-10-29 02:51:15 37. 5518 0.005 442.98 KiB 0.003 187 1320 ['Trace'] 0.786 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2026-10-29 02:51:15 38. 5363 0.005 712.72 KiB 0.005 1 89 ['Trace'] 0.007 PREWHERE condition was split into {} steps: {}
2026-10-29 02:51:15 39. 5084 0.005 392.22 KiB 0.003 1 104 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2026-10-29 02:51:15 40. 4753 0.005 430.38 KiB 0.003 150 515 ['Trace'] 0.999 Insert entry {} to queue with type {}
2026-10-29 02:51:15 41. 4705 0.005 666.72 KiB 0.005 1 68 ['Debug'] 0.001 Before join block: '{}'
2026-10-29 02:51:15 42. 4695 0.005 1007.69 KiB 0.007 1 68 ['Debug'] 0.001 After join block: '{}'
2026-10-29 02:51:15 43. 4605 0.004 116.92 KiB 0.001 150 515 ['Debug'] 0.999 Pulled {} entries to queue.
2026-10-29 02:51:15 44. 4605 0.004 265.33 KiB 0.002 150 515 ['Debug'] 0.999 Pulling {} entries to queue: {} - {}
2026-10-29 02:51:15 45. 4070 0.004 455.18 KiB 0.003 118 33 ['Debug'] 1 Fetching part {} from {}:{}
2026-10-29 02:51:15 46. 4020 0.004 141.35 KiB 0.001 1 43 ['Trace'] 1 Keeper request. Address: {}
2026-10-29 02:51:15 47. 3958 0.004 419.39 KiB 0.003 1 35 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2026-10-29 02:51:15 48. 3805 0.004 154.95 KiB 0.001 156 35 ['Debug'] 0.475 Committing part {} to zookeeper
2026-10-29 02:51:15 49. 3723 0.004 260.62 KiB 0.002 159 1138 ['Trace'] 0.013 Running binary search on index range for part {} ({} marks)
2026-10-29 02:51:15 50. 3723 0.004 111.38 KiB 0.001 159 1138 ['Trace'] 0.013 Found (RIGHT) boundary mark: {}
2026-10-29 02:51:15 51. 3723 0.004 115.42 KiB 0.001 159 1138 ['Trace'] 0.013 Found {} range in {} steps
2026-10-29 02:51:15 52. 3723 0.004 107.12 KiB 0.001 159 1138 ['Trace'] 0.013 Found (LEFT) boundary mark: {}
2026-10-29 02:51:15 53. 3658 0.004 291.31 KiB 0.002 1 1314 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2026-10-29 02:51:15 54. 3584 0.003 1.13 MiB 0.008 2 12 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {}
2026-10-29 02:51:15 55. 3579 0.003 129.69 KiB 0.001 17 17 ['Trace'] 1 Flushed system log up to offset {}
2026-10-29 02:51:15 56. 3579 0.003 208.62 KiB 0.001 17 17 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {}
2026-10-29 02:51:15 57. 3508 0.003 138.98 KiB 0.001 153 32 ['Debug'] 0.514 Part {} committed to zookeeper
2026-10-29 02:51:15 58. 3371 0.003 166.40 KiB 0.001 1 297 ['Trace'] 0 Merging partially aggregated blocks (bucket = {}).
2026-10-29 02:51:15 59. 3371 0.003 504.57 KiB 0.004 1 297 ['Debug'] 0 Merged partially aggregated blocks for bucket #{}. Got {} rows, {} from {} source rows in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-10-29 02:51:15 60. 3238 0.003 28.46 KiB 0 2 81 ['Trace'] 0.001 No tables
2026-10-29 02:51:15 61. 3234 0.003 66.33 KiB 0 1 1297 ['Debug'] 1 Stop worker in {}
2026-10-29 02:51:15 62. 3234 0.003 211.73 KiB 0.002 1 955 ['Debug'] 1 Execute load job '{}' in {}
2026-10-29 02:51:15 63. 3234 0.003 221.21 KiB 0.002 1 81 ['Debug'] 0.002 Schedule load job '{}' into {}
2026-10-29 02:51:15 64. 3234 0.003 101.07 KiB 0.001 1 1034 ['Debug'] 0.5 Spawn loader worker #{} in {}
2026-10-29 02:51:15 65. 3234 0.003 224.36 KiB 0.002 1 955 ['Debug'] 1 Finish load job '{}' with status {}
2026-10-29 02:51:15 66. 3233 0.003 255.88 KiB 0.002 1 81 ['Debug'] 0.001 Prioritize load job '{}': {} -> {}
2026-10-29 02:51:15 67. 3214 0.003 106.71 KiB 0.001 1 1043 ['Debug'] 0.501 Change current priority: {} -> {}
2026-10-29 02:51:15 68. 3148 0.003 401.51 KiB 0.003 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {}
2026-10-29 02:51:15 69. 3148 0.003 628.40 KiB 0.004 1 512 ['Information'] 1 Removing metadata {} of dropped table {}
2026-10-29 02:51:15 70. 3144 0.003 233.34 KiB 0.002 1 103 ['Debug'] 0.006 Waiting for table {} to be finally dropped
2026-10-29 02:51:15 71. 2873 0.003 115.03 KiB 0.001 1 228 ['Debug'] 0.557 Will use old analyzer to prepare mutation
2026-10-29 02:51:15 72. 2791 0.003 87.22 KiB 0.001 1 26 ['Debug'] 1 Receive four letter command {}
2026-10-29 02:51:15 73. 2638 0.003 395.82 KiB 0.003 1 719 ['Information'] 0 Done writing part of data into temporary file {}, compressed {}, uncompressed {}
2026-10-29 02:51:15 74. 2638 0.003 298.84 KiB 0.002 1 729 ['Information'] 0 Sorting and writing part of data into temporary file {}
2026-10-29 02:51:15 75. 2560 0.002 305.19 KiB 0.002 734 16 ['Trace'] 1 Executing log entry to merge parts {} to {}
2026-10-29 02:51:15 76. 2500 0.002 224.85 KiB 0.002 1 1143 ['Debug'] 0 Merge sorted {} blocks, {} rows in {} sec., {} rows/sec., {}/sec
2026-10-29 02:51:15 77. 2321 0.002 199.46 KiB 0.001 118 34 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2026-10-29 02:51:15 78. 2321 0.002 83.83 KiB 0.001 118 34 ['Trace'] 1 Checking disk {} with type {}
2026-10-29 02:51:15 79. 2309 0.002 442.17 KiB 0.003 1 68 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2026-10-29 02:51:15 80. 2274 0.002 184.39 KiB 0.001 1 56 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2026-10-29 02:51:15 81. 2274 0.002 77.65 KiB 0.001 1 56 ['Debug'] 0 Selected MergeAlgorithm: {}
2026-10-29 02:51:15 82. 2245 0.002 290.36 KiB 0.002 1 56 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2026-10-29 02:51:15 83. 2242 0.002 141.47 KiB 0.001 312 56 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2026-10-29 02:51:15 84. 2225 0.002 143.40 KiB 0.001 1 83 ['Trace'] 0.008 {}Join data is being destroyed, {} bytes and {} rows in hash table
2026-10-29 02:51:15 85. 2133 0.002 68.05 KiB 0 19 40 ['Debug'] 0 Requested flush up to offset {}
2026-10-29 02:51:15 86. 2126 0.002 110.15 KiB 0.001 281 534 ['Debug'] 0.807 Selected {} parts from {} to {}
2026-10-29 02:51:15 87. 1957 0.002 129.95 KiB 0.001 1 297 ['Debug'] 0 Will kill query {} (synchronously)
2026-10-29 02:51:15 88. 1930 0.002 239.80 KiB 0.002 1 2 ['Trace'] 1 MemoryTracking: was {}, peak {}, free memory in arenas {}, will set to {} (RSS), difference: {}
2026-10-29 02:51:15 89. 1894 0.002 394.07 KiB 0.003 71 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it
2026-10-29 02:51:15 90. 1831 0.002 211.12 KiB 0.002 786 424 ['Debug'] 0.914 Removing {} parts from filesystem (serially): Parts: [{}]
2026-10-29 02:51:15 91. 1824 0.002 42.77 KiB 0 97 43 ['Trace'] 1 Sending part {}
2026-10-29 02:51:15 92. 1816 0.002 154.28 KiB 0.001 116 33 ['Trace'] 0.999 Disk for fetch is not provided, getting disk from reservation {} with type '{}'
2026-10-29 02:51:15 93. 1816 0.002 34.03 KiB 0 116 33 ['Debug'] 0.999 Downloading files {}
2026-10-29 02:51:15 94. 1814 0.002 83.30 KiB 0.001 115 33 ['Debug'] 0.999 Downloading part {} onto disk {}.
2026-10-29 02:51:15 95. 1807 0.002 98.87 KiB 0.001 115 33 ['Debug'] 0.999 Download of part {} onto disk {} finished.
2026-10-29 02:51:15 96. 1803 0.002 209.09 KiB 0.001 114 31 ['Debug'] 0.999 Fetched part {} from {}:{}{}
2026-10-29 02:51:15 97. 1769 0.002 122.13 KiB 0.001 42 378 ['Trace'] 1 Adding mutation {} for {} partitions (data versions: {})
2026-10-29 02:51:15 98. 1759 0.002 115.09 KiB 0.001 46 26 ['Information'] 1 Fetching of part was cancelled
2026-10-29 02:51:15 99. 1740 0.002 126.81 KiB 0.001 1 94 ['Trace'] 0.012 The min valid primary key position for moving to the tail of PREWHERE is {}
2026-10-29 02:51:15 100. 1717 0.002 45.27 KiB 0 41 380 ['Trace'] 1 Mutation {} is done
2026-10-29 02:51:15
2026-10-29 02:51:15
2026-10-29 02:51:15
2026-10-29 02:51:15 Top messages without format string (fmt::runtime):
2026-10-29 02:51:15
2026-10-29 02:51:15 count pattern runtime_message line
2026-10-29 02:51:15
2026-10-29 02:51:15 1. 16 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 1 ('SEECTwrong'): SEECTwrong. Expected one of: Query, Query with output, EXPLAIN, EXPLAIN, SELECT query, possibly with UNION, list of union elements, SELECT query, subquery, possibly with UNION, SEL ('/executeQuery.cpp',219)
2026-10-29 02:51:15 2. 6 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2026-10-29 02:51:15 3. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',219)
2026-10-29 02:51:15 4. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:32778) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying ('/executeQuery.cpp',219)
2026-10-29 02:51:15 5. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:44098) (comment: 02843_backup_use_sam ('/executeQuery.cpp',219)
2026-10-29 02:51:15 6. 2 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_0.data_01850?. Stack trace:
2026-10-29 02:51:15
2026-10-29 02:51:15 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String cons ('/executeQuery.cpp',219)
2026-10-29 02:51:15 7. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 8. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 9. 1 PocoExceptionCodeecodeNetExcepti Poco::Exception. Code: 1000, e.code() = 107, Net Exception: Socket is not connected, Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:15
2026-10-29 02:51:15 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, ('/Exception.cpp',222)
2026-10-29 02:51:15 10. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:15
2026-10-29 02:51:15 0. ./contrib/llvm-project/libcxx/include/exception:141: st ('/TCPHandler.cpp',701)
2026-10-29 02:51:15 11. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0
2026-10-29 02:51:15 peer 1, DC ID 0, localhost:9234, voting member, 1
2026-10-29 02:51:15 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 12. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 13. 1 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 14. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 15. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:15
2026-10-29 02:51:15 0. ./contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char const ('/TCPHandler.cpp',701)
2026-10-29 02:51:15 16. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_rkvnbzrj/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',222)
2026-10-29 02:51:15 17. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0)
2026-10-29 02:51:15 18. 1 stdexceptionCodetypeavroExceptio std::exception. Code: 1001, type: avro::Exception, e.what() = Cannot read compressed data, expected at least 4 bytes, got 0 (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:34712) (comment: 02373_heap_buffer_overflow_in_avro.sh) (in quer ('/executeQuery.cpp',219)
2026-10-29 02:51:15 19. 1 INITRAFTSERVERcommitindextermele === INIT RAFT SERVER ===
2026-10-29 02:51:15 commit index 0
2026-10-29 02:51:15 term 0
2026-10-29 02:51:15 election timer allowed
2026-10-29 02:51:15 log store start 1, end 0
2026-10-29 02:51:15 config log idx 0, prev log idx 0
2026-10-29 02:51:15 -- ASYNC REPLICATION -- ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 20. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:35386) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitm ('/executeQuery.cpp',219)
2026-10-29 02:51:15 21. 1 configatindexiscommittedprevconf config at index 1 is committed, prev config log idx 0 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 22. 1 startingup starting up ('',0)
2026-10-29 02:51:15 23. 1 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 24. 1 PRIORITYdecaytargetmine [PRIORITY] decay, target 1 -> 1, mine 1 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 25. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 26. 1 globalmanagerdoesnotexistwilluse global manager does not exist. will use local thread for commit and append ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 27. 1 peerDCIDlocalhostvotingmembermyi peer 1: DC ID 0, localhost:9234, voting member, 1
2026-10-29 02:51:15 my id: 1, voting_member
2026-10-29 02:51:15 num peers: 0 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 28. 1 newconfiglogidxprevlogidxcurconf new config log idx 1, prev log idx 0, cur config log idx 0, prev log idx 0 ('/LoggerWrapper.h',43)
2026-10-29 02:51:15 29. 1 ELECTIONTIMEOUTcurrentrolefollow [ELECTION TIMEOUT] current role: follower, log last term 0, state term 0, target p 1, my p 1, hb dead, pre-vote NOT done ('/LoggerWrapper.h',43)
2026-10-29 02:51:25 30. 1 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43)
2026-10-29 02:51:25
2026-10-29 02:51:25
2026-10-29 02:51:25
2026-10-29 02:51:25 Top messages not matching their format strings:
2026-10-29 02:51:25
2026-10-29 02:51:25 message_format_string count() any_message
2026-10-29 02:51:25
2026-10-29 02:51:25 1. Query {} to stage {}{} 32 Query SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('����')) AS `stringJaccardIndexUTF8(materialize('hello'), materialize('����'))` FROM system.one AS __table1 to stage Complete
2026-10-29 02:51:25 message_format_string count() any_message
2026-10-29 02:51:25
2026-10-29 02:51:25 2. Query {} from stage {} to stage {}{} 32 Query SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('����')) AS `stringJaccardIndexUTF8(materialize('hello'), materialize('����'))` FROM system.one AS __table1 from stage FetchColumns to stage Complete
2026-10-29 02:51:25 message_format_string count() any_message
2026-10-29 02:51:25
2026-10-29 02:51:25 3. 31 Forked a child process to watch
2026-10-29 02:51:25 message_format_string count() any_message
2026-10-29 02:51:25
2026-10-29 02:51:25 4. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.3.18.10427.altinitystable (altinity build)) (from [::1]:60944) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2026-10-29 02:51:25
2026-10-29 02:51:25 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003a555553
2026-10-29 02:51:25 1. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001cb490b0
2026-10-29 02:51:25 2. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x000000000c904436
2026-10-29 02:51:25 3. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x000000000c909615
2026-10-29 02:51:25 4. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000c905c34
2026-10-29 02:51:25 5. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b53896c
2026-10-29 02:51:25 6. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000029bde05e
2026-10-29 02:51:25 7. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000029bdfe1f
2026-10-29 02:51:25 8. ./build_docker/./src/Functions/IFunction.cpp:412: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000029be467e
2026-10-29 02:51:25 9. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000002c41e5f1
2026-10-29 02:51:25 10. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x000000003309b64c
2026-10-29 02:51:25 11. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x0000000021df995e
2026-10-29 02:51:25 12. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000032854a8d
2026-10-29 02:51:25 13. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x00000000328ab1ce
2026-10-29 02:51:25 14. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x000000003288bde3
2026-10-29 02:51:25 15. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x0000000032888534
2026-10-29 02:51:25 16. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000032887e3f
2026-10-29 02:51:25 17. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:94: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x00000000328b5085
2026-10-29 02:51:25 18. ./base/base/../base/wide_integer_impl.h:810: ThreadPoolImpl::worker(std::__list_iterator) @ 0x000000001cd4e740
2026-10-29 02:51:25 19. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15000]>, void ThreadPoolImpl::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>>(void*) @ 0x000000001cd5b94d
2026-10-29 02:51:25 20. asan_thread_start(void*) @ 0x000000000a7b9f1b
2026-10-29 02:51:25 21. ? @ 0x00007f8b20295ac3
2026-10-29 02:51:25 22. ? @ 0x00007f8b20327850
2026-10-29 02:51:25
2026-10-29 02:51:25 message_format_string count() any_message
2026-10-29 02:51:25
2026-10-29 02:51:25 5. (from {}{}{}){}{} {} (stage: {}) 1 (from [::1]:35392) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator:
2026-10-29 02:51:25 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$
������������������������������������������������������������������������ ��'���X+��'���X+��'���URLHashInt64�|3��b.��|3��b.��|3��b.��|3��b.��
2026-10-29 02:51:25 o���e��
�#�\X-h��X v�v����h��9�D�|3��b.�CLIDInt32 � $$); (stage: Complete)
2026-10-29 02:51:25 message_format_string count() any_message
2026-10-29 02:51:25
2026-10-29 02:51:29 6. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 1 /var/lib/clickhouse/store/a96/a96af886-3c07-478a-8d47-c608a3b871f8/tmp_merge_202610_61_87_5/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages)
2026-10-29 02:51:29
2026-10-29 02:51:29
2026-10-29 02:51:29
2026-10-29 02:51:29 Top short messages:
2026-10-29 02:51:29
2026-10-29 02:51:29 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2026-10-29 02:51:29
2026-10-29 02:51:29 1. 90 {}:{}: '{}' src/Processors/Transforms/MergeJoinTransform.cpp:836: ' Nullable(size = 50, UInt32(size = 50), UInt8(size = 50)) UInt32( 62
2026-10-29 02:51:29 2. 12 Illegal UTF-8 sequence, while processing '{}' Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8 -1
2026-10-29 02:51:29 3. 10 Creating {}: {} Creating table test_wjsyfwmu_2.src: CREATE TABLE IF NOT EXISTS test_wjsyfwmu_2.src UUID '74a2350b-c29f-4a67-b759-38feab6 124
2026-10-29 02:51:29 4. 5 {} Server was built with sanitizer. It will work slowly. 27
2026-10-29 02:51:29 5. 4 Froze {} parts Froze 1 parts -13
2026-10-29 02:51:29 6. 2 Unknown statistic column: {} Code: 708. DB::Exception: Unknown statistic column: b. (ILLEGAL_STATISTIC) (version 24.3.18.10427.altinitystable (altini 29
2026-10-29 02:51:29
2026-10-29 02:51:29
2026-10-29 02:51:29
2026-10-29 02:51:29 Top messages by level:
2026-10-29 02:51:29
2026-10-29 02:51:29 (0.003444905068066672,'Number of arguments for function {} doesn\'t match: passed {}, should be {}') Error
2026-10-29 02:51:29 (0.00021722894681447207,'Not enabled four letter command {}') Warning
2026-10-29 02:51:29 (0.003025826214920168,'Removing metadata {} of dropped table {}') Information
2026-10-29 02:51:29 (0.049333078297578666,'(from {}{}{}){}{} {} (stage: {})') Debug
2026-10-29 02:51:29 (0.057660828718820195,'Access granted: {}{}') Trace
2026-10-29 02:51:29
2026-10-29 02:51:29
+ set -e
+ [[ 0 -eq 124 ]]
+ return 0
Files in current directory
+ echo 'Files in current directory'
+ ls -la ./
total 128068
drwxr-xr-x 1 root root 4096 Oct 29 02:42 .
drwxr-xr-x 1 root root 4096 Oct 29 02:42 ..
-rw-rw-r-- 1 1000 1000 300 Oct 29 02:10 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 1566 Oct 27 14:14 attach_gdb.lib
-rw-r--r-- 1 root root 1541 Oct 29 02:34 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4239 Oct 29 02:34 __azurite_db_blob__.json
-rw-r--r-- 1 root root 485987 Oct 29 02:51 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Oct 29 02:14 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 8800 Oct 29 02:10 broken_tests.json
drwxr-x--- 4 root root 4096 Oct 29 02:35 data
drwxr-xr-x 5 root root 340 Oct 29 02:13 dev
-rwxr-xr-x 1 root root 0 Oct 29 02:13 .dockerenv
drwxr-xr-x 1 root root 4096 Oct 29 02:14 etc
drwxr-x--- 2 root root 4096 Oct 29 02:35 flags
drwxr-x--- 2 root root 4096 Oct 29 02:35 format_schemas
drwxr-xr-x 1 1000 1000 4096 Oct 29 02:14 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26931352 Jul 31 2024 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Oct 29 02:35 metadata
drwxr-x--- 2 root root 4096 Oct 29 02:35 metadata_dropped
-rwxr-xr-x 1 root root 103399576 Jul 31 2024 minio
drwxr-xr-x 4 root root 4096 Oct 29 02:14 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-x--- 2 root root 4096 Oct 29 02:35 named_collections
drwxr-xr-x 2 root root 4096 Sep 11 2024 opt
-rw-r--r-- 1 root root 0 Mar 24 2026 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Oct 29 02:13 package_folder
drwxr-x--- 2 root root 4096 Oct 29 02:35 preprocessed_configs
dr-xr-xr-x 316 root root 0 Oct 29 02:13 proc
-rwxrwxr-x 1 root root 8329 Oct 31 2024 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Oct 29 02:18 queries_02352
drwx------ 1 root root 4096 Oct 29 02:20 root
drwxr-xr-x 1 root root 4096 Oct 29 02:14 run
-rwxrwxr-x 1 root root 16095 Oct 27 14:14 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 462 Oct 29 02:14 script.gdb
-rwxrwxr-x 1 root root 10462 Oct 31 2024 setup_export_logs.sh
-rwxrwxr-x 1 root root 351 Oct 27 14:14 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3472 Oct 27 14:14 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 64 Oct 29 02:35 status
drwxr-x--- 4 root root 4096 Oct 29 02:35 store
-rw-rw-r-- 1 root root 13192 Oct 27 14:14 stress_tests.lib
dr-xr-xr-x 13 root root 0 Oct 29 02:13 sys
drwxrwxr-x 2 1000 1000 4096 Oct 29 02:15 test_output
drwxrwxrwt 1 root root 61440 Oct 29 02:51 tmp
drwxr-xr-x 2 root root 4096 Oct 29 02:15 user_defined
drwxr-x--- 2 root root 4096 Oct 29 02:35 user_files
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 833 Oct 27 14:14 utils.lib
-rw-r----- 1 root root 36 Oct 29 02:35 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 128068
drwxr-xr-x 1 root root 4096 Oct 29 02:42 .
drwxr-xr-x 1 root root 4096 Oct 29 02:42 ..
-rw-rw-r-- 1 1000 1000 300 Oct 29 02:10 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 1566 Oct 27 14:14 attach_gdb.lib
-rw-r--r-- 1 root root 1541 Oct 29 02:34 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4239 Oct 29 02:34 __azurite_db_blob__.json
-rw-r--r-- 1 root root 485987 Oct 29 02:51 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Oct 29 02:14 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 8800 Oct 29 02:10 broken_tests.json
drwxr-x--- 4 root root 4096 Oct 29 02:35 data
drwxr-xr-x 5 root root 340 Oct 29 02:13 dev
-rwxr-xr-x 1 root root 0 Oct 29 02:13 .dockerenv
drwxr-xr-x 1 root root 4096 Oct 29 02:14 etc
drwxr-x--- 2 root root 4096 Oct 29 02:35 flags
drwxr-x--- 2 root root 4096 Oct 29 02:35 format_schemas
drwxr-xr-x 1 1000 1000 4096 Oct 29 02:14 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26931352 Jul 31 2024 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Oct 29 02:35 metadata
drwxr-x--- 2 root root 4096 Oct 29 02:35 metadata_dropped
-rwxr-xr-x 1 root root 103399576 Jul 31 2024 minio
drwxr-xr-x 4 root root 4096 Oct 29 02:14 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-x--- 2 root root 4096 Oct 29 02:35 named_collections
drwxr-xr-x 2 root root 4096 Sep 11 2024 opt
-rw-r--r-- 1 root root 0 Mar 24 2026 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Oct 29 02:13 package_folder
drwxr-x--- 2 root root 4096 Oct 29 02:35 preprocessed_configs
dr-xr-xr-x 316 root root 0 Oct 29 02:13 proc
-rwxrwxr-x 1 root root 8329 Oct 31 2024 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Oct 29 02:18 queries_02352
drwx------ 1 root root 4096 Oct 29 02:20 root
drwxr-xr-x 1 root root 4096 Oct 29 02:14 run
-rwxrwxr-x 1 root root 16095 Oct 27 14:14 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 462 Oct 29 02:14 script.gdb
-rwxrwxr-x 1 root root 10462 Oct 31 2024 setup_export_logs.sh
-rwxrwxr-x 1 root root 351 Oct 27 14:14 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3472 Oct 27 14:14 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 64 Oct 29 02:35 status
drwxr-x--- 4 root root 4096 Oct 29 02:35 store
-rw-rw-r-- 1 root root 13192 Oct 27 14:14 stress_tests.lib
dr-xr-xr-x 13 root root 0 Oct 29 02:13 sys
drwxrwxr-x 2 1000 1000 4096 Oct 29 02:15 test_output
drwxrwxrwt 1 root root 61440 Oct 29 02:51 tmp
drwxr-xr-x 2 root root 4096 Oct 29 02:15 user_defined
drwxr-x--- 2 root root 4096 Oct 29 02:35 user_files
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 833 Oct 27 14:14 utils.lib
-rw-r----- 1 root root 36 Oct 29 02:35 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ /process_functional_tests_result.py
2026-10-29 02:51:29,165 File /analyzer_tech_debt.txt with broken tests found
2026-10-29 02:51:29,166 File /broken_tests.json with broken tests found
2026-10-29 02:51:29,166 Broken tests in the list: 73
2026-10-29 02:51:29,166 Find files in result folder test_result.txt,gdb.log,run.log,garbage.log
2026-10-29 02:51:29,174 Is flaky check: False
2026-10-29 02:51:29,174 Result parsed
2026-10-29 02:51:29,175 Result written
+ clickhouse-client -q 'system flush logs'
+ stop_logs_replication
+ echo 'Detach all logs replication'
Detach all logs replication
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ err='++ clickhouse-client -q '\''select * from system.query_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.query_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\4 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
++ clickhouse-client -q 'select * from system.query_log format TSVWithNamesAndTypes'
++ zstd --threads=0
++ clickhouse-client -q 'select * from system.zookeeper_log format TSVWithNamesAndTypes'
++ zstd --threads=0
+ err='++ clickhouse-client -q '\''select * from system.zookeeper_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.zookeeper_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\8 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
++ clickhouse-client -q 'select * from system.trace_log format TSVWithNamesAndTypes'
++ zstd --threads=0
+ err='++ clickhouse-client -q '\''select * from system.trace_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.trace_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\4 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
++ clickhouse-client -q 'select * from system.transactions_info_log format TSVWithNamesAndTypes'
++ zstd --threads=0
+ err='++ clickhouse-client -q '\''select * from system.transactions_info_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.transactions_info_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\1\6 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ err='++ clickhouse-client -q '\''select * from system.metric_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.metric_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\5 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ sudo clickhouse stop
++ clickhouse-client -q 'select * from system.metric_log format TSVWithNamesAndTypes'
++ zstd --threads=0
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Sent terminate signal to process with pid 678.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 678.
The process with pid = 678 does not exist.
Server stopped
+ [[ -n '' ]]
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ zstd --threads=0
+ '[' 1 -ne 0 ']'
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.query_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.zookeeper_log format TSVWithNamesAndTypes'
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.trace_log format TSVWithNamesAndTypes'
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.transactions_info_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.metric_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ -n '' ]]